CF510157
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF510157 vs. ExPASy Swiss-Prot
Match: RL15_QUESU (60S ribosomal protein L15 OS=Quercus suber GN=RPL15 PE=2 SV=1) HSP 1 Score: 89.7373 bits (221), Expect = 8.149e-24 Identity = 42/57 (73.68%), Postives = 49/57 (85.96%), Query Frame = 3 Query: 51 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 221 MGAY +V+E+ R+KQSDV+RFL RVRCWEYRQ I R +RP+RPDKARRLGYKAKQ Sbjct: 1 MGAYKYVAEMERRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQ 57 HSP 2 Score: 40.817 bits (94), Expect = 8.149e-24 Identity = 16/23 (69.57%), Postives = 18/23 (78.26%), Query Frame = 1 Query: 262 RKRPVPKGIVYGKPTNQGVTQLK 330 RKRP PKG +GKP NQG+ QLK Sbjct: 71 RKRPAPKGATFGKPVNQGINQLK 93
BLAST of CF510157 vs. ExPASy Swiss-Prot
Match: RL15_NEUCR (60S ribosomal protein L15 OS=Neurospora crassa GN=rpl-15 PE=3 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 5.147e-23 Identity = 40/57 (70.18%), Postives = 46/57 (80.70%), Query Frame = 3 Query: 51 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 221 MGA ++ EL +KKQSDV+RFL RVRCWE RQ I R +RP+RPDKARRLGYKAKQ Sbjct: 1 MGALKYLEELQKKKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQ 57 HSP 2 Score: 45.0542 bits (105), Expect = 5.147e-23 Identity = 19/23 (82.61%), Postives = 20/23 (86.96%), Query Frame = 1 Query: 262 RKRPVPKGIVYGKPTNQGVTQLK 330 RK+PVPKG YGKPTNQGV QLK Sbjct: 71 RKKPVPKGATYGKPTNQGVNQLK 93
BLAST of CF510157 vs. ExPASy Swiss-Prot
Match: RL15_CHITE (60S ribosomal protein L15 OS=Chironomus tentans GN=RpL15 PE=3 SV=3) HSP 1 Score: 90.5077 bits (223), Expect = 8.715e-23 Identity = 41/57 (71.93%), Postives = 48/57 (84.21%), Query Frame = 3 Query: 51 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 221 MGAY +V EL+RKKQSDV+R+L RVRCW+YRQ + R RP+RPDKARRLGYKAKQ Sbjct: 1 MGAYRYVQELYRKKQSDVLRYLLRVRCWQYRQLTKLHRAPRPSRPDKARRLGYKAKQ 57 HSP 2 Score: 36.5798 bits (83), Expect = 8.715e-23 Identity = 16/23 (69.57%), Postives = 17/23 (73.91%), Query Frame = 1 Query: 262 RKRPVPKGIVYGKPTNQGVTQLK 330 RKRPV KG YGKP + GV QLK Sbjct: 71 RKRPVHKGCTYGKPKSHGVNQLK 93
BLAST of CF510157 vs. ExPASy Swiss-Prot
Match: RL15_ANOGA (60S ribosomal protein L15 OS=Anopheles gambiae GN=RpL15 PE=2 SV=3) HSP 1 Score: 86.6557 bits (213), Expect = 1.134e-22 Identity = 40/57 (70.18%), Postives = 46/57 (80.70%), Query Frame = 3 Query: 51 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 221 MGAY +V EL+RKKQSDVMR+L R+R W+YRQ R RP+RPDKARRLGYKAKQ Sbjct: 1 MGAYRYVQELYRKKQSDVMRYLLRIRVWQYRQMTRFHRAPRPSRPDKARRLGYKAKQ 57 HSP 2 Score: 40.0466 bits (92), Expect = 1.134e-22 Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1 Query: 262 RKRPVPKGIVYGKPTNQGVTQLK 330 RKRPVPKG YGKP + GV QLK Sbjct: 71 RKRPVPKGCTYGKPKSHGVNQLK 93
BLAST of CF510157 vs. ExPASy Swiss-Prot
Match: RL15_ASPNG (60S ribosomal protein L15 OS=Aspergillus niger GN=rpl15 PE=2 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 1.134e-22 Identity = 40/57 (70.18%), Postives = 47/57 (82.46%), Query Frame = 3 Query: 51 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 221 MGA +V E+ +KKQSDV+RFL RVRCWE RQ +I R +RP+RPDKARRLGYKAKQ Sbjct: 1 MGALKYVEEIQKKKQSDVIRFLLRVRCWELRQLNAIHRASRPSRPDKARRLGYKAKQ 57 HSP 2 Score: 42.3578 bits (98), Expect = 1.134e-22 Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1 Query: 262 RKRPVPKGIVYGKPTNQGVTQLK 330 RKRP PKG YGKPTN G+ QLK Sbjct: 71 RKRPAPKGATYGKPTNMGINQLK 93
BLAST of CF510157 vs. ExPASy Swiss-Prot
Match: RL15_DROME (60S ribosomal protein L15 OS=Drosophila melanogaster GN=RpL15 PE=2 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 1.920e-22 Identity = 39/57 (68.42%), Postives = 47/57 (82.46%), Query Frame = 3 Query: 51 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 221 MGAY ++ EL+RKKQSDVMR+L R+R W+YRQ + R RPTRPDKARRLGY+AKQ Sbjct: 1 MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQ 57 HSP 2 Score: 40.0466 bits (92), Expect = 1.920e-22 Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1 Query: 262 RKRPVPKGIVYGKPTNQGVTQLK 330 RKRPVPKG YGKP + GV QLK Sbjct: 71 RKRPVPKGCTYGKPKSHGVNQLK 93
BLAST of CF510157 vs. ExPASy Swiss-Prot
Match: RL15_ORCLI (60S ribosomal protein L15 OS=Orconectes limosus GN=RPL15 PE=2 SV=3) HSP 1 Score: 84.7297 bits (208), Expect = 4.229e-22 Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 3 Query: 51 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 221 MGAY ++ E++RKKQSDVMRFL R+R W+YR + R RPTRP+KARRLGYKAKQ Sbjct: 1 MGAYKYMQEIYRKKQSDVMRFLLRIRAWQYRHLNKLHRAPRPTRPEKARRLGYKAKQ 57 HSP 2 Score: 40.0466 bits (92), Expect = 4.229e-22 Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1 Query: 262 RKRPVPKGIVYGKPTNQGVTQLK 330 RKRPVPKG YGKP + GV QLK Sbjct: 71 RKRPVPKGATYGKPKSHGVNQLK 93
BLAST of CF510157 vs. ExPASy Swiss-Prot
Match: RL15B_SCHPO (60S ribosomal protein L15-B OS=Schizosaccharomyces pombe GN=rpl15b PE=1 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 2.670e-21 Identity = 40/57 (70.18%), Postives = 45/57 (78.95%), Query Frame = 3 Query: 51 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 221 MGAY ++ EL +KKQSDV FL RVR WEYRQ I R +RP+RPDKARRLGYKAKQ Sbjct: 1 MGAYKYLEELAKKKQSDVNLFLSRVRAWEYRQMNVIHRASRPSRPDKARRLGYKAKQ 57 HSP 2 Score: 39.6614 bits (91), Expect = 2.670e-21 Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1 Query: 262 RKRPVPKGIVYGKPTNQGVTQLK 330 RKRPVPKG YGKP +QGV LK Sbjct: 71 RKRPVPKGQTYGKPVHQGVNHLK 93
BLAST of CF510157 vs. ExPASy Swiss-Prot
Match: RL15A_SCHPO (60S ribosomal protein L15-A OS=Schizosaccharomyces pombe GN=rpl15a PE=2 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 2.670e-21 Identity = 40/57 (70.18%), Postives = 45/57 (78.95%), Query Frame = 3 Query: 51 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 221 MGAY ++ EL +KKQSDV FL RVR WEYRQ I R +RP+RPDKARRLGYKAKQ Sbjct: 1 MGAYKYLEELAKKKQSDVNLFLSRVRAWEYRQMNVIHRASRPSRPDKARRLGYKAKQ 57 HSP 2 Score: 39.6614 bits (91), Expect = 2.670e-21 Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1 Query: 262 RKRPVPKGIVYGKPTNQGVTQLK 330 RKRPVPKG YGKP +QGV LK Sbjct: 71 RKRPVPKGQTYGKPVHQGVNHLK 93
BLAST of CF510157 vs. ExPASy Swiss-Prot
Match: RL15_CAEEL (60S ribosomal protein L15 OS=Caenorhabditis elegans GN=rpl-15 PE=2 SV=1) HSP 1 Score: 86.6557 bits (213), Expect = 7.643e-21 Identity = 37/57 (64.91%), Postives = 47/57 (82.46%), Query Frame = 3 Query: 51 MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 221 MGAY ++ E+WRKKQSD +R+L R+R W YRQ ++ RV RPTRP+KARRLGY+AKQ Sbjct: 1 MGAYKYMQEIWRKKQSDALRYLLRIRTWHYRQLSAVHRVPRPTRPEKARRLGYRAKQ 57 HSP 2 Score: 33.8834 bits (76), Expect = 7.643e-21 Identity = 15/23 (65.22%), Postives = 16/23 (69.57%), Query Frame = 1 Query: 262 RKRPVPKGIVYGKPTNQGVTQLK 330 RKRPV KG YGKP GV +LK Sbjct: 71 RKRPVCKGQTYGKPKTHGVNELK 93 The following BLAST results are available for this feature:
BLAST of CF510157 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 43
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF510157 ID=CF510157; Name=CF510157; organism=Citrus sinensis; type=EST; length=331bpback to top |