CF831961
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF831961 vs. ExPASy Swiss-Prot
Match: UCRI_RICTY (Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia typhi GN=petA PE=3 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 1.727e-13 Identity = 37/66 (56.06%), Postives = 49/66 (74.24%), Query Frame = 1 Query: 484 SMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFITRRTEEDIKLANSVDLGSLRDPQQDAER 681 S++ S DVLA++S+EVDLSSI G TVTVKW+GKP+FIT RT + I A +V + L DP++D R Sbjct: 40 SLNPSTDVLALSSIEVDLSSIAIGQTVTVKWQGKPIFITNRTPDGIASARAVKMSELIDPEKDEVR 105
BLAST of CF831961 vs. ExPASy Swiss-Prot
Match: UCRI_RICPR (Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia prowazekii GN=petA PE=3 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 1.727e-13 Identity = 36/66 (54.55%), Postives = 49/66 (74.24%), Query Frame = 1 Query: 484 SMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFITRRTEEDIKLANSVDLGSLRDPQQDAER 681 S + S DVLA++S+EVDLS+I G TVTVKW+GKP+FIT RT ++I A +V + L DP++D R Sbjct: 40 SFNPSADVLALSSIEVDLSNIAIGQTVTVKWQGKPIFITNRTHDEIAAARAVKMSELIDPERDEVR 105
BLAST of CF831961 vs. ExPASy Swiss-Prot
Match: UCRI_RICFE (Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia felis GN=petA PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 3.848e-13 Identity = 37/66 (56.06%), Postives = 48/66 (72.73%), Query Frame = 1 Query: 484 SMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFITRRTEEDIKLANSVDLGSLRDPQQDAER 681 S++ S DVLA++S+EVDLS+I G TVTVKW+GKPVFIT RT + I A +V + L DP+ D R Sbjct: 40 SLNPSADVLALSSIEVDLSNIAVGQTVTVKWQGKPVFITNRTPDKIAEARAVKMSELIDPETDEAR 105
BLAST of CF831961 vs. ExPASy Swiss-Prot
Match: UCRI_RICCN (Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia conorii GN=petA PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 3.848e-13 Identity = 37/66 (56.06%), Postives = 48/66 (72.73%), Query Frame = 1 Query: 484 SMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFITRRTEEDIKLANSVDLGSLRDPQQDAER 681 S++ S DVLA++S+EVDLS+I G TVTVKW+GKPVFIT RT + I A +V + L DP+ D R Sbjct: 40 SLNPSADVLALSSIEVDLSNIAVGQTVTVKWQGKPVFITNRTPDKIAEARAVKMSELIDPEADQAR 105
BLAST of CF831961 vs. ExPASy Swiss-Prot
Match: UCRI_PARDE (Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Paracoccus denitrificans GN=petA PE=1 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 3.848e-13 Identity = 39/89 (43.82%), Postives = 55/89 (61.80%), Query Frame = 1 Query: 394 SKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFITRRTEEDIKLANSVDLGSLRD 660 ++R F Y+ G V A ++ M+ S DV A+AS++VD+S +E G+ +TVKW GKPVFI RRTE++I+ VDLG L D Sbjct: 14 TRRDFLYYATAGAGTVAAGAAAWTLVN---QMNPSADVQALASIQVDVSGVETGTQLTVKWLGKPVFIRRRTEDEIQAGREVDLGQLID 99
BLAST of CF831961 vs. ExPASy Swiss-Prot
Match: UCRI_RHOSH (Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rhodobacter sphaeroides GN=petA PE=1 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 1.910e-12 Identity = 40/89 (44.94%), Postives = 54/89 (60.67%), Query Frame = 1 Query: 394 SKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFITRRTEEDIKLANSVDLGSLRD 660 ++R F Y+ G V + + M+ S DV A+AS+ VD+SS+EPG +TVK+ GKP+FI RRTE DI+L SV LG L D Sbjct: 10 TRRDFLYYATAGAGAVATGAA---VWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVD 95 The following BLAST results are available for this feature:
BLAST of CF831961 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 36
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF831961 ID=CF831961; Name=CF831961; organism=Citrus sinensis; type=EST; length=682bpback to top |