CF832020

Overview
NameCF832020
Unique NameCF832020
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length840
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6288 contig Csv1_Contig6288:778..1617. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDIA3_HUMAN (Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4)

HSP 1 Score: 107.071 bits (266), Expect = 1.304e-22
Identity = 56/156 (35.90%), Postives = 87/156 (55.77%), Query Frame = -2
Query:  378 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVP--YEGDRTKEDIVDFIENNRDKAAPKETVKEESGK 839
            D   +  ++++Y +G +  + KS              VA++  ++V N  K+VL+EFYAPWCGHCK L P   E+      D ++VIAK DATAND+P   +EV+G+PT++F  A+ K  P  YEG R   D + +++    +A     ++EE  K
Sbjct:  345 DGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVP-SPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQR---EATNPPVIQEEKPK 496          

HSP 2 Score: 68.1662 bits (165), Expect = 6.711e-11
Identity = 39/117 (33.33%), Postives = 61/117 (52.14%), Query Frame = -2
Query:  378 DSLQDMVFNSGKN--VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGK 722
            D+ +  + ++G    +L+EF+APWCGHCK+LAP  +  A   +    V +AK D TAN    + + V GYPT+       +   Y+G RT + IV  ++     A+     +EE  K
Sbjct:   33 DNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLK--GIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKK 147          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDIA3_CERAE (Protein disulfide-isomerase A3 OS=Cercopithecus aethiops GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.304e-22
Identity = 56/156 (35.90%), Postives = 87/156 (55.77%), Query Frame = -2
Query:  378 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVP--YEGDRTKEDIVDFIENNRDKAAPKETVKEESGK 839
            D   +  ++++Y +G +  + KS              VA++  ++V N  K+VL+EFYAPWCGHCK L P   E+      D ++VIAK DATAND+P   +EV+G+PT++F  A+ K  P  YEG R   D + +++    +A     ++EE  K
Sbjct:  345 DGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVP-SPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQR---EATNPPVIQEEKPK 496          

HSP 2 Score: 68.5514 bits (166), Expect = 5.138e-11
Identity = 40/117 (34.19%), Postives = 61/117 (52.14%), Query Frame = -2
Query:  378 DSLQDMVFNSGKN--VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGK 722
            D+ +  V ++G    +L+EF+APWCGHCK+LAP  +  A   +    V +AK D TAN    + + V GYPT+       +   Y+G RT + IV  ++     A+     +EE  K
Sbjct:   33 DNFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLK--GIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKK 147          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI2_DICDI (Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.224e-22
Identity = 54/141 (38.30%), Postives = 80/141 (56.74%), Query Frame = -2
Query:  411 DQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA 833
            D ++ W+++   GKV PF KS              V  + + +V +S K+VL+EFYAPWCGHCK LAPI D++    ++   V I K DA +ND+P D  E++GYPT+    A  K  P   +  + D ++F+E  +D AA
Sbjct:  347 DTVSKWIQDVIGGKVSPFVKSQPEPESNDAPVKVAVGTTFKKLVLDSPKDVLVEFYAPWCGHCKNLAPIYDKLGEYLKDVESVSIVKIDADSNDVPSD-IEIRGYPTIMLFKADDKENPISYEGQRNDHMNFVEFIQDNAA 486          

HSP 2 Score: 77.411 bits (189), Expect = 1.106e-13
Identity = 40/84 (47.62%), Postives = 52/84 (61.90%), Query Frame = -2
Query:  432 LLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPT-VFFRSASGKTVPYEGDRTKEDIVDFIE 680
            L+ FYAPWCGHCK L P+ +E A     +  + IAK D T ++      +VQGYPT V F+  +GK  PYEGDRT + IV  +E
Sbjct:   62 LVMFYAPWCGHCKTLKPLYEEAAKQLSANKKIAIAKVDCTQHEQLCKQNKVQGYPTLVVFK--NGKAEPYEGDRTTKSIVQTLE 143          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI_DROME (Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.904e-22
Identity = 58/163 (35.58%), Postives = 95/163 (58.28%), Query Frame = -2
Query:  369 ADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADS-LQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENN---RDKAAPKETVKEESG--KDEL 836
            A+ I  ++K++ +GK+     S              +  S  + +  +  K+VL+EFYAPWCGHCK+LAPI D++A  Y+++ D+VIAK D+TAN++  ++ ++  +PT+ +FR    K + +  DRT +D V F++ N    D    +ET +EE    KDEL
Sbjct:  336 AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANEL--ESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVADSEPVEETEEEEEAPKKDEL 496          

HSP 2 Score: 71.633 bits (174), Expect = 6.070e-12
Identity = 38/85 (44.71%), Postives = 52/85 (61.18%), Query Frame = -2
Query:  435 VLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFI 683
            VL+EFYAPWCGHCK LAP   + A    + ++ + +AK DAT      + + V+GYPT+ FFR  SG  V Y G R   DI+ ++
Sbjct:   47 VLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFR--SGSPVEYSGGRQAADIIAWV 129          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDIA3_CHICK (Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.459e-21
Identity = 56/153 (36.60%), Postives = 85/153 (55.56%), Query Frame = -2
Query:  387 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVP--YEGDRTKEDIVDFIENNRDKAAPKETVKEE 839
            D   +  ++++Y +G +  + KS              VA++  ++V    K+VL+EFYAPWCGHCK L P   E+      D ++VIAK DATAND+P   +EV+G+PT++F  A  K  P  YEG R   ++ DFI   + +A     ++EE
Sbjct:  343 DGKALERFLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVP-SPYEVRGFPTIYFAPAGKKQSPKKYEGGR---EVSDFISYLKREATSTPVLQEE 491          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDIA1_CHICK (Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3)

HSP 1 Score: 102.449 bits (254), Expect = 3.211e-21
Identity = 55/158 (34.81%), Postives = 90/158 (56.96%), Query Frame = -2
Query:  372 ADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVAD-SLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKDE 836
            AD+I  +  ++ EGK+ P   S              +   + +++ F+  KNV +EFYAPWCGHCK+LAPI D++  +Y++  ++VIAK D+TAN++  +  ++  +PT+ FF + SG+ V  Y G+RT E    F+E+     A  +   E+   DE
Sbjct:  341 ADKIKEFCNKFLEGKIKPHLMSQDLPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYRDHENIVIAKMDSTANEV--EAVKIHSFPTLKFFPAGSGRNVIDYNGERTLEGFKKFLESGGQDGAAADDDLEDLETDE 496          

HSP 2 Score: 70.0922 bits (170), Expect = 1.766e-11
Identity = 37/96 (38.54%), Postives = 54/96 (56.25%), Query Frame = -2
Query:  411 KNVLLEFYAPWCGHCKKLAPILDEVAVSYQND-ADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVP--YEGDRTKEDIVDFIENNRDKAA 689
            +++L+EFYAPWCGHCK LAP   + A   + + +++ +AK DAT        F V+GYPT+ F     K  P  Y   R  +DIV +++     AA
Sbjct:   47 RHLLVEFYAPWCGHCKALAPEYAKAAAQLKAEGSEIRLAKVDATEEAELAQQFGVRGYPTIKFFRNGDKAAPREYTAGREADDIVSWLKKRTGPAA 142          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI2_CAEEL (Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.211e-21
Identity = 56/157 (35.67%), Postives = 86/157 (54.78%), Query Frame = -2
Query:  372 DQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVAD-SLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIE-NNRDKAAPKETVKEESGKDE 833
            + I+ + + Y +G V P   S              +   + + +  ++ KNVL+EFYAPWCGHCK+LAP  D++   + +D  +VIAK D+T N++  +  ++Q +PT+ FF + S K V Y GDRT E    F+E N ++ A   E  K E   DE
Sbjct:  333 ENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEV--EDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEGAGASEEEKAEEEADE 487          

HSP 2 Score: 77.0258 bits (188), Expect = 1.445e-13
Identity = 40/102 (39.22%), Postives = 58/102 (56.86%), Query Frame = -2
Query:  411 DMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQND-ADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA 710
            D V N  + +L+EFYAPWCGHCK LAP   + A   + + +D+ + K DAT +      FEV+GYPT+  FR  +GK   Y G R  + I+ +++      A
Sbjct:   34 DEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFR--NGKPQEYNGGRDHDSIIAWLKKKTGPVA 133          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDIA1_RABIT (Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.637e-20
Identity = 54/153 (35.29%), Postives = 86/153 (56.21%), Query Frame = -2
Query:  387 ADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVAD-SLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAAPKETVKEE 836
            A+ I  + + + EGK+ P   S              +   + +++ F+  KNV +EFYAPWCGHCK+LAPI D++  +Y+   D+VIAK D+TAN++  +  +V  +PT+ FF +  G+TV  Y G+RT +    F+E+     A  E   E+
Sbjct:  337 AEGITEFCQRFLEGKIKPHLMSQELPEDWDRQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKEHQDIVIAKMDSTANEV--EAVKVHSFPTLKFFPAGPGRTVIDYNGERTLDGFKKFLESGGQDGAGDEDGLED 487          

HSP 2 Score: 69.3218 bits (168), Expect = 3.012e-11
Identity = 42/124 (33.87%), Postives = 69/124 (55.65%), Query Frame = -2
Query:  342 KNVLLEFYAPWCGHCKKLAPILDEVAVSYQND-ADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSA-SGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKDEL*EG-----MGMFRE 689
            K++L+EFYAPWCGHCK LAP   + A   + + +D+ +AK DAT        + V+GYPT+ FF++  +     Y   R  +DIV++++     AA   T+ + +  + L E      +G F++
Sbjct:   43 KHLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSDIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAA--TTLADSAAAESLVESSEVAVIGFFKD 164          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: BS2_TRYBB (Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.056e-20
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = -2
Query:  372 DQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENN----RDKAAPKETVKEESGKDE 833
            + +  ++ E+  G+V P  KS              +          SGK++L+ F+APWCGHCK  AP  D++A  + +  D+++A+ DATAN +   TF V  +PTVFF    GK V +EG+R+ E++ +F+  +    +    P    +E+  ++E
Sbjct:  319 ESLEKFILEFAAGRVEPTIKSLPVPEVETVDGKTTIVAKTMQKHLTSGKDMLILFFAPWCGHCKNFAPTFDKIAKEF-DATDLIVAELDATANYVNSSTFTVTAFPTVFFVPNGGKPVVFEGERSFENVYEFVRKHVTTFKVSEKPANVTEEKKSEEE 475          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDIA1_PONAB (Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.301e-19
Identity = 51/145 (35.17%), Postives = 85/145 (58.62%), Query Frame = -2
Query:  411 ADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVAD-SLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAA 836
            A++I  +   + EGK+ P   S              +   + +D+ F+  KNV +EFYAPWCGHCK+LAPI D++  +Y++  ++VIAK D+TAN++  +  +V  +PT+ FF +++ +TV  Y G+RT +    F+E+     A
Sbjct:  336 AERITEFCHRFLEGKIKPHLMSQELPDDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEV--EAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA 478          
The following BLAST results are available for this feature:
BLAST of CF832020 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 70
Match NameE-valueIdentityDescription
PDIA3_HUMAN1.304e-2235.90Protein disulfide-isomerase A3 OS=Homo sapiens GN=... [more]
PDIA3_CERAE1.304e-2235.90Protein disulfide-isomerase A3 OS=Cercopithecus ae... [more]
PDI2_DICDI2.224e-2238.30Protein disulfide-isomerase 2 OS=Dictyostelium dis... [more]
PDI_DROME2.904e-2235.58Protein disulfide-isomerase OS=Drosophila melanoga... [more]
PDIA3_CHICK2.459e-2136.60Protein disulfide-isomerase A3 OS=Gallus gallus GN... [more]
PDIA1_CHICK3.211e-2134.81Protein disulfide-isomerase OS=Gallus gallus GN=P4... [more]
PDI2_CAEEL3.211e-2135.67Protein disulfide-isomerase 2 OS=Caenorhabditis el... [more]
PDIA1_RABIT4.637e-2035.29Protein disulfide-isomerase OS=Oryctolagus cunicul... [more]
BS2_TRYBB6.056e-2031.01Bloodstream-specific protein 2 OS=Trypanosoma bruc... [more]
PDIA1_PONAB2.301e-1935.17Protein disulfide-isomerase OS=Pongo abelii GN=P4H... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01C23_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01C23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832020 ID=CF832020|Name=CF832020|organism=Citrus sinensis|type=EST|length=840bp
TTTTTTTTTTTTTTGGACGTAATAAGCAAAATCCGAAATAATTAACGCAT
TAAATTAAAATTATCCATTACGGATTTAACACGCAGTAAGTTACTCCTAG
GCCGAAAATACTAATATCACAACTATGCGAATACCAAAAAGTACTGCAGC
TACAAATGCCAAAAATGCCTCCCCATTTTATTCACGGGAACAGAACAGAT
CTGTAAAGGGAAATGGCCTCAGAAAAAGCTATAAGGGGGGATATAGGACA
AGGGGGAGGAGAACATCAGGCATTGTTTTGTCGACACTGATAGTTTTGGT
ATAACATCCGCCAAACACGCGCCAACCGACTATGTGCACGGCTCTCTAAA
CATACCCATTCCTTCTTAGAGCTCATCTTTTCCAGATTCCTCTTTTACAG
TTTCCTTGGGGGCAGCTTTGTCCCTGTTATTTTCAATGAAGTCAACAATA
TCTTCTTTGGTCCTATCCCCCTCATAGGGCACTGTCTTTCCACTAGCAGA
TCGGAAGAACACGGTTGGGTAACCTTGGACTTCAAAGGTGTCACCAGGAA
TATCATTTGCGGTTGCATCAAATTTTGCAATAACAACATCAGCATCATTT
TGATATGAGACAGCAACTTCATCCAAGATTGGAGCCAACTTTTTGCAGTG
TCCACACCAAGGAGCGTAAAACTCGAGCAAAACATTTTTTCCAGAGTTGA
AAACCATGTCCTGAAGGCTGTCAGCAACAACCACTTTCACAGGCTCGTTG
TTCTCTTCAGGGATAGGCTCAGACTTTCTGAATGGGGGAACCTTGCCTTC
CTTGTATTCCTTCACCCAAGGTGCAATCTGATCGGCATCC
back to top