CF832024

Overview
NameCF832024
Unique NameCF832024
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length848
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1001 contig Csv1_Contig1001:731..1578. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: SN114_SCHPO (114 kDa U5 small nuclear ribonucleoprotein component homolog OS=Schizosaccharomyces pombe GN=cwf10 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 9.057e-40
Identity = 82/179 (45.81%), Postives = 115/179 (64.25%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQ------------AAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            L +E +R + F + DVVL  + I+RGGGQ+IPTARRV Y+S LTA PRL+EPVYMVE+ AP  +L  IY +L ++RGHV +++ RPG+PLY ++A +PVI+S GF   LR  T GQA  Q VFDHW ++  DPL+   +            A   +   R+RKGL E ++    F+ ++
Sbjct:  792 LCDETIRNVNFRLMDVVLAPEQIYRGGGQIIPTARRVCYSSFLTASPRLMEPVYMVEVHAPADSLPIIYDLLTRRRGHVLQDIPRPGSPLYLVRALIPVIDSCGFETDLRVHTQGQAMCQMVFDHWQVVPGDPLDKSIKPKPLEPARGSDLARDFLIKTRRRKGLVEDVSTTRYFDQEM 970          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: U5S1_CHICK (116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.708e-38
Identity = 77/179 (43.02%), Postives = 112/179 (62.57%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGT------------QAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            L +E +R + F++ D V+  + +HRGGGQ+IPTARRV+Y++ L A PRL+EP Y VE+QAP   +  +Y+VL ++RGHV ++   PG+PLY IKA++P I+SFGF   LR  T GQAF   VF HW ++  DPL+                A + +   R+RKGL E ++    F+D +
Sbjct:  779 LCDELIRNVKFKILDAVIAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPM 957          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: U5S1_PONAB (116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 2.231e-38
Identity = 77/179 (43.02%), Postives = 112/179 (62.57%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGT------------QAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            L +E +R + F++ D V+  + +HRGGGQ+IPTARRV+Y++ L A PRL+EP Y VE+QAP   +  +Y+VL ++RGHV ++   PG+PLY IKA++P I+SFGF   LR  T GQAF   VF HW ++  DPL+                A + +   R+RKGL E ++    F+D +
Sbjct:  779 LCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPM 957          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: U5S1_MOUSE (116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 2.231e-38
Identity = 77/179 (43.02%), Postives = 112/179 (62.57%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGT------------QAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            L +E +R + F++ D V+  + +HRGGGQ+IPTARRV+Y++ L A PRL+EP Y VE+QAP   +  +Y+VL ++RGHV ++   PG+PLY IKA++P I+SFGF   LR  T GQAF   VF HW ++  DPL+                A + +   R+RKGL E ++    F+D +
Sbjct:  778 LCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPM 956          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: U5S1_HUMAN (116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 2.231e-38
Identity = 77/179 (43.02%), Postives = 112/179 (62.57%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGT------------QAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            L +E +R + F++ D V+  + +HRGGGQ+IPTARRV+Y++ L A PRL+EP Y VE+QAP   +  +Y+VL ++RGHV ++   PG+PLY IKA++P I+SFGF   LR  T GQAF   VF HW ++  DPL+                A + +   R+RKGL E ++    F+D +
Sbjct:  779 LCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPM 957          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: U5S1_BOVIN (116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 2.231e-38
Identity = 77/179 (43.02%), Postives = 112/179 (62.57%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGT------------QAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            L +E +R + F++ D V+  + +HRGGGQ+IPTARRV+Y++ L A PRL+EP Y VE+QAP   +  +Y+VL ++RGHV ++   PG+PLY IKA++P I+SFGF   LR  T GQAF   VF HW ++  DPL+                A + +   R+RKGL E ++    F+D +
Sbjct:  779 LCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPM 957          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_THENV (Elongation factor 2 OS=Thermoproteus neutrophilus (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.188e-23
Identity = 60/163 (36.81%), Postives = 96/163 (58.90%), Query Frame = -1
Query:  357 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEF 845
            LA+E MRG+   + D V+H D  HRG  Q++P  +  I+A+ L+A+P +LEP+  ++I+     +G + SVLN+ RG + +  Q+    +  ++A LPV+ESF  S  LRAA +G+ F    F  W  M      P +  A +V  +RK+KGLKE++   ++F
Sbjct:  582 LAQEPMRGLKVVLTDAVVHEDPAHRGPAQIMPATKNAIFAAVLSARPTILEPLMKLDIKVAPDYIGAVTSVLNKHRGKILDMTQQ--EYMAYLRAELPVLESFTISDELRAAAAGKIFWSMQFSRWAPM------PESILADMVKQLRKKKGLKEEIPKPTDF 736          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_STAMF (Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=fusA PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.648e-23
Identity = 61/156 (39.10%), Postives = 90/156 (57.69%), Query Frame = -1
Query:  378 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQ 845
            LA E +RG+   + D ++H D  HRG GQ+ P  R  IYA  LTAKP LLEP+  ++I+AP + LG I +++ +KRG + + +Q+    +  I A +PV E+F  +  LR AT+G+A     F  W  +      P +    LV  IR+RKGLK +
Sbjct:  579 LAMEPVRGVKVILHDAIIHEDPAHRGPGQIYPAVRNAIYAGMLTAKPTLLEPIQKLDIKAPMEYLGNITTIITKKRGKILQVLQQGA--VARIIAEIPVAETFDLAEQLRGATAGKAIWGQEFSRWAPV------PDSMLLDLVRKIRERKGLKPE 726          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_PYRIL (Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189) GN=fusA PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.648e-23
Identity = 59/163 (36.20%), Postives = 95/163 (58.28%), Query Frame = -1
Query:  357 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEF 845
            LA+E +RG+   + D V+H D  HRG  Q++P  +  I+A+ L+AKP +LEP+  ++I+     +G + SVLN+ RG + +  Q+    +  ++A LPV+ESF  S  LRAA +G+ F    F  W  +      P +    LV  +RK+KGLKE++   ++F
Sbjct:  582 LAQEPIRGVKVVLVDAVVHEDPAHRGPAQIMPATKNAIFAAMLSAKPTVLEPLLRLDIKVAPDYIGAVTSVLNKHRGKILDMTQQ--EYMAYLRAELPVLESFTISDELRAAAAGKIFWSMQFSRWAPV------PESMLLDLVKQLRKKKGLKEEIPKPTDF 736          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_PYRAE (Elongation factor 2 OS=Pyrobaculum aerophilum GN=fusA PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.516e-23
Identity = 59/163 (36.20%), Postives = 92/163 (56.44%), Query Frame = -1
Query:  357 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEF 845
            LA+E MRG+   + D V+H D  HRG  Q++P  +  I+A+ L+A+P LLEP+  ++I+     +G + SVLN+ RG + +  Q+       ++A LPV+ESF  S  LRAA +G+ F    F  W         P +     V  +RK+KGLKE++   ++F
Sbjct:  582 LAQEPMRGVKVVLVDAVVHEDPAHRGPAQIMPATKNAIFAAVLSARPTLLEPLMRLDIKVAPDYIGAVTSVLNKHRGKILDMTQQEYMAF--LRAELPVLESFNISDELRAAAAGKIFWSMQFARWAPF------PESMLGDFVKQLRKKKGLKEEIPKPTDF 736          
The following BLAST results are available for this feature:
BLAST of CF832024 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
SN114_SCHPO9.057e-4045.81114 kDa U5 small nuclear ribonucleoprotein compone... [more]
U5S1_CHICK1.708e-3843.02116 kDa U5 small nuclear ribonucleoprotein compone... [more]
U5S1_PONAB2.231e-3843.02116 kDa U5 small nuclear ribonucleoprotein compone... [more]
U5S1_MOUSE2.231e-3843.02116 kDa U5 small nuclear ribonucleoprotein compone... [more]
U5S1_HUMAN2.231e-3843.02116 kDa U5 small nuclear ribonucleoprotein compone... [more]
U5S1_BOVIN2.231e-3843.02116 kDa U5 small nuclear ribonucleoprotein compone... [more]
EF2_THENV1.188e-2336.81Elongation factor 2 OS=Thermoproteus neutrophilus ... [more]
EF2_STAMF2.648e-2339.10Elongation factor 2 OS=Staphylothermus marinus (st... [more]
EF2_PYRIL2.648e-2336.20Elongation factor 2 OS=Pyrobaculum islandicum (str... [more]
EF2_PYRAE4.516e-2336.20Elongation factor 2 OS=Pyrobaculum aerophilum GN=f... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D01_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832024 ID=CF832024|Name=CF832024|organism=Citrus sinensis|type=EST|length=848bp
TAATAATATATCAACCAACGTCGGCCAGAATTAGTCCTTCACATGACAGA
ACATCAAACCTTAAAAGCTGTGAATTGTAAAATTTAAAACCTAGATGACA
GAGACAGGGTTACTAAACCCAATCAACAGTAATATTACTTTACTAAACAC
AATGAGGATATTGAAAAACTTTGAAACAAAAATAAGCATCAGCAAAAAAT
ATTGCTGCGCAATCTCACCCTTGATGTCAAGATGAAATGTTTACAGCTCG
TCCTCTACTCGGATAGCGGTGTCATTTGCTCCCTCTTCCTGATATCAGCA
ACAAGCTGCGCAATCTCACCCTTGATGTCAAGACGAAATGTTTACAGCTT
GTCCTCAAACTCAGATAGTGGTGTCATTTGCTCCTTCAAGCCCTTCCTCT
TCCTGATATCAGCAACAAGCTGTGCAGCCTGTGTACCAGGCTCCAGTGGA
TCGGATGACATCATGTCCCAGTGATCAAACACACATTGTGGGAAGGCCTG
TCCTGACGTTGCAGCCCTCAAAGTGCCTGAGAATCCAAAGGACTCGATGA
CGGGAAGGTAAGCCTTGATGTTGTAAAGGGGGGTACCAGGTCTCTGCATT
TCCTCGAACACGTGACCACGTTTCTGATTGAGAACACTGTAAATACCACC
AAGGGCCTGCTCGGGAGCCTGTATTTCGACCATGTAGACAGGCTCAAGAA
GCCTGGGCTTGGCTGTGAGCTGGGAAGCATATATGACCCTCCTAGCAGTA
GGAATGACTTGACCACCACCTCTGTGAATGGCATCAGCATGAAGAACAAC
ATCACATACTTCAAAGCAGATACCTCTCATGTTCTCTTCAGCCAGCGC
back to top