CF832035

Overview
NameCF832035
Unique NameCF832035
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length803
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig610 contig Csv1_Contig610:1050..1854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUC4_ARATH (Sucrose transport protein SUC4 OS=Arabidopsis thaliana GN=SUC4 PE=1 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 9.230e-31
Identity = 78/175 (44.57%), Postives = 106/175 (60.57%), Query Frame = -1
Query:  279 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLPSTTADVPPPI 803
            MLN++ LG TS+ +E L +   G   +WG+ N L+A+  +   +IT    S+        G      PP  +   A+ IFT+LGIP AIT+SVP+A+ SI   +   GQGLSLGVLNLAIV+PQ++VS+ SGP+D + GGGN PA  VGA    + GIVA+  LP T    P P+
Sbjct:  344 MLNSVFLGITSVLMEKLCRK-WGAGFVWGISNILMAICFL-GMIITSFVASHL-------GYIGHEQPPASIVFAAVLIFTILGIPLAITYSVPYALISIRIESLGLGQGLSLGVLNLAIVIPQVIVSVGSGPWDQLFGGGNSPALAVGAATGFIGGIVAILALPRTRIQKPIPL 509          
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUC3_ARATH (Sucrose transport protein SUC3 OS=Arabidopsis thaliana GN=SUC3 PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.513e-28
Identity = 65/169 (38.46%), Postives = 113/169 (66.86%), Query Frame = -1
Query:  297 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLPSTTA 803
            +LN++VLG +S  +E + + +G  + +W + NF +   +  T +I+ ++ S+ ++     G  +I+      +  A+ +F +LG P AIT+SVPF++ +  +  S  GQGL++GVLNLAIV+PQM+VSL +GP+D + GGGN+PAF++ +VAA  +G++AL  LP+ ++
Sbjct:  422 LLNSVVLGISSFLIEPMCQRMGA-RVVWALSNFTVFACMAGTAVISLMSLSDDKN-----GIEYIMRGNETTRTAAVIVFALLGFPLAITYSVPFSVTAEVTADSGGGQGLAIGVLNLAIVIPQMIVSLGAGPWDQLFGGGNLPAFVLASVAAFAAGVIALQRLPTLSS 584          
The following BLAST results are available for this feature:
BLAST of CF832035 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
SUC4_ARATH9.230e-3144.57Sucrose transport protein SUC4 OS=Arabidopsis thal... [more]
SUC3_ARATH2.513e-2838.46Sucrose transport protein SUC3 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D08_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832035 ID=CF832035|Name=CF832035|organism=Citrus sinensis|type=EST|length=803bp
TTTTTTTTTTTTTTTACGAACAAACACCTTGTCAATTATTTCACTCACTA
AACAAGTAACAACATACATTTAAACTCCATACACACACAAGCCTTGCAGC
CATGCACCACATTCATTTACTTACCAGCAGAATTATTTTCCCAAAAGTAC
TCAGCGGTTAGGCACATTTCGGATGACTTAAAAAAAAAAGAAAAAAGTCC
GTCCCTTCTTTATGTCCAACAAACTAAGACTAGCTAGTACTTATTAGTTT
GATTTGCGGTTGCAGTTCCCGCTTCAGTTATCGGCGGGGGAACATCCGCG
GTTGTTGATGGGAGCAGGGTGAGTGCAACGATACCACTTAAGGCAGCCGC
AACTGCGCCGACCATAAAGGCCGGCATGTTGCCACCTCCGCAAACGGCAT
CAAAGGGTCCGCTAAGTAAAGACACCAGCATCTGTGGAACAACTATTGCA
AGATTCAAAACACCCAACGAAAGCCCTTGACCAGCAGCAGAAGTTCTAGA
AAATATGGATGCCATAGCAAACGGAACGCTGAAAGTAATAGCTTGAGGAA
TTCCCAACACAGTGAAGATAGCCAAAGCGCCAACTTTCACACCAACCGGC
GGCGGCAAGATATGGGTGGCTCCGCCTGCTGTGGTGACGGACCGGCGGTT
GGACTCGGCCAATTTGGTAATCAAAAAGGTGAAAACCAAAGAAACCGCCA
ACAAGAAATTGACAACGCCCCAGAGCCTCTTGACGCCACCAATCAGCTTC
GCCAAGACCTCCACACCCAGCGACGTGAACCCCAGAACGATAGCGTTAAG
CAT
back to top