CF832285
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF832285 vs. ExPASy Swiss-Prot
Match: RS12_PYRIL (30S ribosomal protein S12P OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189) GN=rps12p PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.759e-11 Identity = 32/52 (61.54%), Postives = 44/52 (84.62%), Query Frame = 1 Query: 1 LNYIHENDEVLIAGFGR-KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 153 LNYI+E+DEV+I G +G ++GDIPGVRFKV+KV+GVSL A+++ KK+KP Sbjct: 94 LNYINEHDEVIIERIGGPEGRSLGDIPGVRFKVIKVNGVSLWAIWRGKKQKP 145
BLAST of CF832285 vs. ExPASy Swiss-Prot
Match: RS12_PYRCJ (30S ribosomal protein S12P OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps12p PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.759e-11 Identity = 33/52 (63.46%), Postives = 44/52 (84.62%), Query Frame = 1 Query: 1 LNYIHENDEVLIAGFGR-KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 153 LNYI+E+DEV+I G +G ++GDIPGVRFKVVKV+GVSL A+++ KK+KP Sbjct: 94 LNYINEHDEVIIERIGGPEGKSLGDIPGVRFKVVKVNGVSLWAIWRGKKQKP 145
BLAST of CF832285 vs. ExPASy Swiss-Prot
Match: RS12_PYRAE (30S ribosomal protein S12P OS=Pyrobaculum aerophilum GN=rps12p PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.522e-11 Identity = 32/52 (61.54%), Postives = 44/52 (84.62%), Query Frame = 1 Query: 1 LNYIHENDEVLIAGFGR-KGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKP 153 LNYI+E+DEV+I G +G ++GDIPGVRFKV+KV+GVSL A+++ KK+KP Sbjct: 94 LNYINEHDEVVIERIGGPEGRSLGDIPGVRFKVIKVNGVSLWAIWRGKKQKP 145 The following BLAST results are available for this feature:
BLAST of CF832285 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 33
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF832285 ID=CF832285; Name=CF832285; organism=Citrus sinensis; type=EST; length=358bpback to top |