CF834833
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF834833 vs. ExPASy Swiss-Prot
Match: MRH1_ARATH (Probable LRR receptor-like serine/threonine-protein kinase MRH1 OS=Arabidopsis thaliana GN=MRH1 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.074e-11 Identity = 36/91 (39.56%), Postives = 53/91 (58.24%), Query Frame = -2 Query: 248 LDLGNSNISGTWGPEVGQLQHLQYLELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTL 520 LDL ++ GT PE+ QL L+ L L N SG IPKE G+ ++L +D+ +N L G+IP +N SLK L L+ NK + + ++ L Sbjct: 75 LDLSGYSLEGTLAPELSQLSDLRSLILSRNHFSGGIPKEYGSFENLEVLDLRENDLSGQIPPELSNGLSLKHLLLSGNKFSDDMRIKIVRL 165
BLAST of CF834833 vs. ExPASy Swiss-Prot
Match: Y1143_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g14390 OS=Arabidopsis thaliana GN=At1g14390 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.239e-11 Identity = 41/111 (36.94%), Postives = 59/111 (53.15%), Query Frame = -2 Query: 194 LDLGNSNISGTWGPEV--GQLQHLQYLELYMNDISGKIPKELGNLKSLVSMDMYQNKLEGEIPKSFANLKSLKFLRLNNNKLTGSIPRELTTLSDLKVFDVSNNGLCGTIP 520 L+LG + + GPEV +L + L N KIP+++ L L S+D+ NK G IP+ +L SL+ L L N L+GS+P S L++ DVS N L G +P Sbjct: 184 LNLGGNKL----GPEVVPSLASNLITISLKNNSFGSKIPEQIKKLNKLQSLDLSSNKFTGSIPRFLLSLPSLQNLSLAQNLLSGSLPNSSLCNSKLRILDVSRNLLTGKLP 290 The following BLAST results are available for this feature:
BLAST of CF834833 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 92
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF834833 ID=CF834833; Name=CF834833; organism=Citrus sinensis; type=EST; length=560bpback to top |