CF834862
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_MAIZE (Ubiquitin OS=Zea mays GN=UBF9 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1 Query: 183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_LUPPO (Ubiquitin OS=Lupinus polyphyllus PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1 Query: 183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_LUPAL (Ubiquitin OS=Lupinus albus PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1 Query: 183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_LINUS (Ubiquitin OS=Linum usitatissimum PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1 Query: 183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_HORVU (Ubiquitin OS=Hordeum vulgare GN=MUB1 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1 Query: 183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_HELAN (Ubiquitin OS=Helianthus annuus PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1 Query: 183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_EUPEU (Ubiquitin OS=Euplotes eurystomus PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1 Query: 183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_ENCCU (Ubiquitin OS=Encephalitozoon cuniculi GN=ECU02_0740i PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = -1 Query: 180 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF 278 FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+ Sbjct: 45 FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGY 77
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_DESAN (Ubiquitin OS=Deschampsia antarctica PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1 Query: 183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CF834862 vs. ExPASy Swiss-Prot
Match: UBIQ_DAUCA (Ubiquitin OS=Daucus carota PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.347e-11 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -1 Query: 183 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 278 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 45 FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76 The following BLAST results are available for this feature:
BLAST of CF834862 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 69
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF834862 ID=CF834862; Name=CF834862; organism=Citrus sinensis; type=EST; length=278bpback to top |