CF972317
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF972317 vs. ExPASy Swiss-Prot
Match: DFRA_DIACA (Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1) HSP 1 Score: 99.7525 bits (247), Expect = 4.693e-21 Identity = 46/67 (68.66%), Postives = 58/67 (86.57%), Query Frame = 1 Query: 1 NEVIRPTINGMVSIMRACKNAKTVRRLVFTSSAGTLDVEEHRKPVYDETSWSDLDFVRSVKMTGWMY 201 NE+I+PTINGM+ I+++C AK +RR+VFTSS GT++VE +KPVYDET WS LDF+RSVKMTGWMY Sbjct: 114 NEMIKPTINGMLDILKSCVKAK-LRRVVFTSSGGTVNVEATQKPVYDETCWSALDFIRSVKMTGWMY 179
BLAST of CF972317 vs. ExPASy Swiss-Prot
Match: DFRA_CALCH (Dihydroflavonol-4-reductase OS=Callistephus chinensis GN=F PE=2 SV=1) HSP 1 Score: 98.9821 bits (245), Expect = 8.005e-21 Identity = 43/67 (64.18%), Postives = 58/67 (86.57%), Query Frame = 1 Query: 1 NEVIRPTINGMVSIMRACKNAKTVRRLVFTSSAGTLDVEEHRKPVYDETSWSDLDFVRSVKMTGWMY 201 NE+I+PTI G++SI+R+C AKTV++LV+TSSAGT++V+E + PVYDE+ WSDLDF+ S KMT WMY Sbjct: 98 NEIIKPTIEGILSIIRSCAKAKTVKKLVYTSSAGTVNVQETQLPVYDESHWSDLDFIYSKKMTAWMY 164
BLAST of CF972317 vs. ExPASy Swiss-Prot
Match: DFRA_GERHY (Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=DFR PE=2 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 2.575e-19 Identity = 42/67 (62.69%), Postives = 56/67 (83.58%), Query Frame = 1 Query: 1 NEVIRPTINGMVSIMRACKNAKTVRRLVFTSSAGTLDVEEHRKPVYDETSWSDLDFVRSVKMTGWMY 201 NE+I+PTI G++SI+R+C AKTV++LVFTSSAGT++ +E + VYDE+ WSDLDF+ S KMT WMY Sbjct: 98 NEIIKPTIEGVLSIIRSCVKAKTVKKLVFTSSAGTVNGQEKQLHVYDESHWSDLDFIYSKKMTAWMY 164 The following BLAST results are available for this feature:
BLAST of CF972317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF972317 ID=CF972317; Name=CF972317; organism=Citrus sinensis; type=EST; length=203bpback to top |