CK933906

Overview
NameCK933906
Unique NameCK933906
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length847
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4378 contig Csv1_Contig4378:26..872. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: SSRP1_HUMAN (FACT complex subunit SSRP1 OS=Homo sapiens GN=SSRP1 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.044e-11
Identity = 35/82 (42.68%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRRQAEGTK 465
            DPN PKRP SA+ +++   RE+ K DHP   S+  + K  GE WK MS+  K  +  KAE  + +YEK MK+Y   + E +K
Sbjct:  543 DPNAPKRPMSAYMLWLNASREKIKSDHP-GISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSK 623          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMG3L_HUMAN (High mobility group protein B3-like-1 OS=Homo sapiens GN=HMGB3L1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.044e-11
Identity = 37/83 (44.58%), Postives = 53/83 (63.86%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDY-NRRQAEGTK 465
            DPN PKRP S FF+F  EF  + K  +P   S+  V K  GE W ++++++K PYV K  K K +YEKD+ DY ++ + +GTK
Sbjct:   25 DPNAPKRPLSGFFLFCSEFCPKIKSTNP-GISIGDVAKKLGEMWNNLNDSEKQPYVTKVAKLK-KYEKDVADYKSKGKLDGTK 105          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB2_MOUSE (High mobility group protein B2 OS=Mus musculus GN=Hmgb2 PE=1 SV=3)

HSP 1 Score: 70.4774 bits (171), Expect = 1.363e-11
Identity = 36/76 (47.37%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E R + K +HP   S+    K  GE W   S  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSENRPKIKIEHP-GLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: SSRP1_CHICK (FACT complex subunit SSRP1 OS=Gallus gallus GN=SSRP1 PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 2.325e-11
Identity = 34/74 (45.95%), Postives = 47/74 (63.51%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYN 441
            DPN PKRP SA+ +++   RE+ K DHP   S+  + K  GE WK+MS+  K  +  KAE  K +YEK MK+Y+
Sbjct:  541 DPNAPKRPMSAYMLWLNANREKIKSDHP-GISITDLSKKAGELWKAMSKEKKEEWDRKAEDAKRDYEKAMKEYS 613          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMG3M_HUMAN (Putative high mobility group protein B3-like protein OS=Homo sapiens PE=5 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.036e-11
Identity = 34/83 (40.96%), Postives = 53/83 (63.86%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDY-NRRQAEGTK 465
            DPN PKRP S FF+F  EF  + K  +P    +  V K  GE WK++++++K PY+ +A K K +YEKD+  Y ++ +++G K
Sbjct:   88 DPNAPKRPPSGFFLFCSEFCPKSKSTNP-GIPIGDVAKKLGEMWKNLNDSEKQPYITQAAKLKEKYEKDVAVYKSKGKSDGAK 169          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: SSRP1_ARATH (FACT complex subunit SSRP1 OS=Arabidopsis thaliana GN=SSRP1 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 5.179e-11
Identity = 34/77 (44.16%), Postives = 44/77 (57.14%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRRQ 450
            DPN PKR  S F  F +  R+  KK+HP   +   VGK  G+KW+ MS  DK PY AKA+  K  Y+ ++ DY   Q
Sbjct:  558 DPNAPKRAMSGFMFFSQMERDNIKKEHP-GIAFGEVGKVLGDKWRQMSADDKEPYEAKAQVDKQRYKDEISDYKNPQ 633          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: NHP6_GIBZE (Non-histone chromosomal protein 6 OS=Gibberella zeae GN=NHP6 PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.764e-11
Identity = 35/79 (44.30%), Postives = 47/79 (59.49%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRRQAE 456
            DPN PKR  SA+  F  E RE  ++++P   S   VGK  GE+WK+++E  +APY AKA   K  YE + + YN  Q E
Sbjct:   20 DPNAPKRGLSAYMFFANEQRENVREENP-GISFGQVGKLLGERWKALNEKQRAPYEAKAAADKKRYEDEKQAYNADQEE 97          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGLX_HUMAN (High mobility group protein 1-like 10 OS=Homo sapiens GN=HMG1L10 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 8.834e-11
Identity = 34/76 (44.74%), Postives = 44/76 (57.89%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKR  SAFF+F   +R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRTPSAFFLFCSAYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HGB1A_HUMAN (Putative high mobility group protein B1-like 1 OS=Homo sapiens GN=HMGB1L1 PE=5 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 8.834e-11
Identity = 37/80 (46.25%), Postives = 47/80 (58.75%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRRQAEG 459
            DPN PKRP SAFF+F  E+  + K +HP   S+  V K  GE W + +  DK P   KA K K +YEKD+  Y   QA+G
Sbjct:   91 DPNAPKRPPSAFFLFCSEYHPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPGEKKAAKLKEKYEKDIAAY---QAKG 166          
The following BLAST results are available for this feature:
BLAST of CK933906 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
SSRP1_HUMAN1.044e-1142.68FACT complex subunit SSRP1 OS=Homo sapiens GN=SSRP... [more]
HMG3L_HUMAN1.044e-1144.58High mobility group protein B3-like-1 OS=Homo sapi... [more]
HMGB2_MOUSE1.363e-1147.37High mobility group protein B2 OS=Mus musculus GN=... [more]
SSRP1_CHICK2.325e-1145.95FACT complex subunit SSRP1 OS=Gallus gallus GN=SSR... [more]
HMG3M_HUMAN3.036e-1140.96Putative high mobility group protein B3-like prote... [more]
SSRP1_ARATH5.179e-1144.16FACT complex subunit SSRP1 OS=Arabidopsis thaliana... [more]
NHP6_GIBZE6.764e-1144.30Non-histone chromosomal protein 6 OS=Gibberella ze... [more]
HMGLX_HUMAN8.834e-1144.74High mobility group protein 1-like 10 OS=Homo sapi... [more]
HGB1A_HUMAN8.834e-1146.25Putative high mobility group protein B1-like 1 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G03 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933906 ID=CK933906|Name=CK933906|organism=Citrus sinensis|type=EST|length=847bp
GGGGACACAAACAACGCATCCGCTATTCACATCTGCGTCTCTCTCTTTTT
CTCTTTCCTCTTTTTCTCTCATTTGAAGCCCTAACCCTAGCTCTATCTTT
CTTCAGAAACAGGATTTGAAATGAAAGGAGGTAAATCAAAGTCAGACACC
AGAAACGCCAAGCTCTCTGTGAACAAGAAGCCTGCCAAAGCTGGACGAAA
ATCGGGAAAGGCAGCTAAGGACCCGAACAAGCCAAAGAGGCCAGCCAGCG
CCTTCTTTGTTTTCATGGAAGAATTCCGTGAACAATACAAGAAGGATCAT
CCTAAGAACAAATCAGTTGCTGCTGTTGGTAAAGCTGGTGGTGAGAAATG
GAAGTCAATGTCTGAAGCTGATAAAGCACCGTATGTTGCTAAGGCAGAGA
AGCGCAAGGTTGAGTATGAGAAGGATATGAAAGACTACAATAGGAGACAG
GCGGAGGGAACTAAGCCGGAGGAAGAAGAGGAGTCTGAGAAGTCTATGTC
AGAGGTGAATGATGAGGATGATGATGAAGAAGGCAGTGGCGAGGAGGATG
ATGATGAATAGAAGTTGAAGGAAGAAATTAGCATAGTCATGTTAGGCTGT
GACAATGTTTCAAACAACATATGTTAATGCTTTGTGCTTCCATGTTAATT
TTTTTGGATGCTTTCATCATCTTCATCATCATGTAAGAGAATCATGTTGC
TTCTCCCTCGACATTTTCTTATGCCTGCCTTTCAAAGAATTAATAGCTGT
AGGTGGGAGATTCACTGCTCTATATGTACTGTGTTCTAAAGCTTAATGAT
TTAGCTAAGGCGTTCCATCGTTTGTAAAAAAAAAAAAAAAAAAAAAA
back to top