CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_SOLTU (ADP-ribosylation factor 1 OS=Solanum tuberosum PE=2 SV=2)

HSP 1 Score: 342.813 bits (878), Expect = 1.431e-93
Identity = 170/180 (94.44%), Postives = 174/180 (96.67%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGL+ +KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EAR+EL RML EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSN I N+
Sbjct:    1 MGLTISKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNQIRNQ 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF2_RAT (ADP-ribosylation factor 2 OS=Rattus norvegicus GN=Arf2 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.386e-88
Identity = 161/180 (89.44%), Postives = 168/180 (93.33%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F KLF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVF NKQDLPNAMNAAEITDKLGLHSLRQR+WYIQ+TCATSG+GLYEGLDWLSN + N+
Sbjct:    1 MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNQ 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF2_MOUSE (ADP-ribosylation factor 2 OS=Mus musculus GN=Arf2 PE=1 SV=2)

HSP 1 Score: 326.25 bits (835), Expect = 1.386e-88
Identity = 161/180 (89.44%), Postives = 168/180 (93.33%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F KLF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVF NKQDLPNAMNAAEITDKLGLHSLRQR+WYIQ+TCATSG+GLYEGLDWLSN + N+
Sbjct:    1 MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNQ 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF2_BOVIN (ADP-ribosylation factor 2 OS=Bos taurus GN=ARF2 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.386e-88
Identity = 161/180 (89.44%), Postives = 168/180 (93.33%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F KLF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVF NKQDLPNAMNAAEITDKLGLHSLRQR+WYIQ+TCATSG+GLYEGLDWLSN + N+
Sbjct:    1 MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNQ 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_SCHPO (ADP-ribosylation factor 1 OS=Schizosaccharomyces pombe GN=arf1 PE=2 SV=2)

HSP 1 Score: 325.094 bits (832), Expect = 3.088e-88
Identity = 156/180 (86.67%), Postives = 169/180 (93.89%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGLS +KLF  LF K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY+NISFTVWDVGGQDKIRPLWRHYFQNTQG+IFVVDSNDR+R+ EA +EL RMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLR R WYIQ+TCATSG+GLYEGL+WLS N+ N+
Sbjct:    1 MGLSISKLFQSLFGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYRNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERISEAHEELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRHRQWYIQATCATSGDGLYEGLEWLSTNLKNQ 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_XENLA (ADP-ribosylation factor 1 OS=Xenopus laevis GN=arf1 PE=2 SV=2)

HSP 1 Score: 324.324 bits (830), Expect = 5.268e-88
Identity = 160/180 (88.89%), Postives = 167/180 (92.78%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F  LF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWLSN + N+
Sbjct:    1 MGNMFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF_CRYNE (ADP-ribosylation factor OS=Cryptococcus neoformans GN=ARF PE=1 SV=3)

HSP 1 Score: 323.939 bits (829), Expect = 6.880e-88
Identity = 157/181 (86.74%), Postives = 170/181 (93.92%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 634
            MGLS +KL + LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQG+IFVVDSNDR+R+ EAR+EL RML+EDELRDA+LLVFANKQDLPNAMNAAEITDKLGLHSLRQR WYIQ+ CATSG+GLYEGL+WLS N+  K+
Sbjct:    1 MGLSVSKLLNGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERITEAREELQRMLSEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRSWYIQAACATSGDGLYEGLEWLSANLKRKS 181          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_RAT (ADP-ribosylation factor 1 OS=Rattus norvegicus GN=Arf1 PE=1 SV=2)

HSP 1 Score: 323.939 bits (829), Expect = 6.880e-88
Identity = 160/180 (88.89%), Postives = 167/180 (92.78%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F  LF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWLSN + N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_MOUSE (ADP-ribosylation factor 1 OS=Mus musculus GN=Arf1 PE=1 SV=2)

HSP 1 Score: 323.939 bits (829), Expect = 6.880e-88
Identity = 160/180 (88.89%), Postives = 167/180 (92.78%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F  LF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWLSN + N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_MACFA (ADP-ribosylation factor 1 OS=Macaca fascicularis GN=ARF1 PE=2 SV=3)

HSP 1 Score: 323.939 bits (829), Expect = 6.880e-88
Identity = 160/180 (88.89%), Postives = 167/180 (92.78%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F  LF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWLSN + N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARF1_SOLTU1.431e-9394.44ADP-ribosylation factor 1 OS=Solanum tuberosum PE=... [more]
ARF2_RAT1.386e-8889.44ADP-ribosylation factor 2 OS=Rattus norvegicus GN=... [more]
ARF2_MOUSE1.386e-8889.44ADP-ribosylation factor 2 OS=Mus musculus GN=Arf2 ... [more]
ARF2_BOVIN1.386e-8889.44ADP-ribosylation factor 2 OS=Bos taurus GN=ARF2 PE... [more]
ARF1_SCHPO3.088e-8886.67ADP-ribosylation factor 1 OS=Schizosaccharomyces p... [more]
ARF1_XENLA5.268e-8888.89ADP-ribosylation factor 1 OS=Xenopus laevis GN=arf... [more]
ARF_CRYNE6.880e-8886.74ADP-ribosylation factor OS=Cryptococcus neoformans... [more]
ARF1_RAT6.880e-8888.89ADP-ribosylation factor 1 OS=Rattus norvegicus GN=... [more]
ARF1_MOUSE6.880e-8888.89ADP-ribosylation factor 1 OS=Mus musculus GN=Arf1 ... [more]
ARF1_MACFA6.880e-8888.89ADP-ribosylation factor 1 OS=Macaca fascicularis G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top