CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_HUMAN (ADP-ribosylation factor 1 OS=Homo sapiens GN=ARF1 PE=1 SV=2)

HSP 1 Score: 323.939 bits (829), Expect = 6.880e-88
Identity = 160/180 (88.89%), Postives = 167/180 (92.78%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F  LF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWLSN + N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_BOVIN (ADP-ribosylation factor 1 OS=Bos taurus GN=ARF1 PE=1 SV=2)

HSP 1 Score: 323.939 bits (829), Expect = 6.880e-88
Identity = 160/180 (88.89%), Postives = 167/180 (92.78%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F  LF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWLSN + N+
Sbjct:    1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_LOCMI (ADP-ribosylation factor 1 OS=Locusta migratoria GN=ARF1 PE=2 SV=2)

HSP 1 Score: 322.783 bits (826), Expect = 1.533e-87
Identity = 158/179 (88.27%), Postives = 166/179 (92.74%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAN 628
            MG  F  LF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+ EAR+EL RML EDELRDAVLL+FANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWLSN + N
Sbjct:    1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_DROME (ADP-ribosylation factor 1 OS=Drosophila melanogaster GN=Arf79F PE=1 SV=2)

HSP 1 Score: 322.783 bits (826), Expect = 1.533e-87
Identity = 158/179 (88.27%), Postives = 166/179 (92.74%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAN 628
            MG  F  LF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+ EAR+EL RML EDELRDAVLL+FANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWLSN + N
Sbjct:    1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF_DUGJA (ADP-ribosylation factor OS=Dugesia japonica PE=2 SV=3)

HSP 1 Score: 322.013 bits (824), Expect = 2.614e-87
Identity = 159/181 (87.85%), Postives = 166/181 (91.71%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 634
            MG   T L  RLF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RMLNEDELRDAVLLVFANKQDLPNAMN AEITDKLGLHSLR R WYIQ+TCATSG+GLYEGLDWLS  + N++
Sbjct:    1 MGNLVTHLLDRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRS 181          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF12_CAEBR (ADP-ribosylation factor 1-like 2 OS=Caenorhabditis briggsae GN=arf-1.2 PE=3 SV=3)

HSP 1 Score: 320.472 bits (820), Expect = 7.607e-87
Identity = 158/181 (87.29%), Postives = 166/181 (91.71%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 634
            MG  F  LF  LF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVFANKQDLP AMNAAE+TDKLGLHSLR R WYIQ+TCATSG+GLYEGLDWLSN + N++
Sbjct:    1 MGNVFGSLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKNRS 181          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF_NEUCR (ADP-ribosylation factor OS=Neurospora crassa GN=NCU08340 PE=3 SV=3)

HSP 1 Score: 319.316 bits (817), Expect = 1.695e-86
Identity = 155/177 (87.57%), Postives = 165/177 (93.22%), Query Frame = 2
Query:  104 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 634
            F KLF  LF KKEMRILMVGLDAAGKTTILYKLKLGE+VTTIPTIGFNVETVEYKNI FTVWDVGGQDKIRPLWRHYFQNTQG+IFVVDSNDRDRVVEAR+EL RMLNEDELRDA+LLVFANKQDLPNAMNAAEITDKLGL SLRQR WYIQ+TCAT+G+GL+EGLDWLS  +  K+
Sbjct:    8 FGKLFDGLFGKKEMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKNIQFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLSSLRQRSWYIQATCATTGDGLFEGLDWLSTELKKKS 184          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF3_TAKRU (ADP-ribosylation factor 3 OS=Takifugu rubripes GN=arf3 PE=3 SV=2)

HSP 1 Score: 319.316 bits (817), Expect = 1.695e-86
Identity = 158/180 (87.78%), Postives = 165/180 (91.67%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F  L   L  KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWL+N + NK
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF3_RAT (ADP-ribosylation factor 3 OS=Rattus norvegicus GN=Arf3 PE=2 SV=2)

HSP 1 Score: 319.316 bits (817), Expect = 1.695e-86
Identity = 158/180 (87.78%), Postives = 165/180 (91.67%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F  L   L  KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWL+N + NK
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF3_PONAB (ADP-ribosylation factor 3 OS=Pongo abelii GN=ARF3 PE=2 SV=3)

HSP 1 Score: 319.316 bits (817), Expect = 1.695e-86
Identity = 158/180 (87.78%), Postives = 165/180 (91.67%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F  L   L  KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV EAR+EL RML EDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR R+WYIQ+TCATSG+GLYEGLDWL+N + NK
Sbjct:    1 MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK 180          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARF1_HUMAN6.880e-8888.89ADP-ribosylation factor 1 OS=Homo sapiens GN=ARF1 ... [more]
ARF1_BOVIN6.880e-8888.89ADP-ribosylation factor 1 OS=Bos taurus GN=ARF1 PE... [more]
ARF1_LOCMI1.533e-8788.27ADP-ribosylation factor 1 OS=Locusta migratoria GN... [more]
ARF1_DROME1.533e-8788.27ADP-ribosylation factor 1 OS=Drosophila melanogast... [more]
ARF_DUGJA2.614e-8787.85ADP-ribosylation factor OS=Dugesia japonica PE=2 S... [more]
ARF12_CAEBR7.607e-8787.29ADP-ribosylation factor 1-like 2 OS=Caenorhabditis... [more]
ARF_NEUCR1.695e-8687.57ADP-ribosylation factor OS=Neurospora crassa GN=NC... [more]
ARF3_TAKRU1.695e-8687.78ADP-ribosylation factor 3 OS=Takifugu rubripes GN=... [more]
ARF3_RAT1.695e-8687.78ADP-ribosylation factor 3 OS=Rattus norvegicus GN=... [more]
ARF3_PONAB1.695e-8687.78ADP-ribosylation factor 3 OS=Pongo abelii GN=ARF3 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top