CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL1_BOVIN (ADP-ribosylation factor-like protein 1 OS=Bos taurus GN=ARL1 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.446e-55
Identity = 103/180 (57.22%), Postives = 134/180 (74.44%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F+ +FS LF  +EMRIL++GLD AGKTTILY+L++GE+VTTIPTIGFNVETV YKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDR+  ++ EL  ML E+ELR A+L+VFANKQD+  AM  +E+ + LGL +L+ R W I  T AT G GL E ++WL   + ++
Sbjct:    1 MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL1_RAT (ADP-ribosylation factor-like protein 1 OS=Rattus norvegicus GN=Arl1 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 4.501e-55
Identity = 103/180 (57.22%), Postives = 134/180 (74.44%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F+ +FS LF  +EMRIL++GLD AGKTTILY+L++GE+VTTIPTIGFNVETV YKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDR+  ++ EL  ML E+ELR A+L+VFANKQD+  AM  +E+ + LGL +L+ R W I  T AT G GL E ++WL   + ++
Sbjct:    1 MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANALGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL1_MOUSE (ADP-ribosylation factor-like protein 1 OS=Mus musculus GN=Arl1 PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 4.501e-55
Identity = 103/180 (57.22%), Postives = 134/180 (74.44%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F+ +FS LF  +EMRIL++GLD AGKTTILY+L++GE+VTTIPTIGFNVETV YKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDR+  ++ EL  ML E+ELR A+L+VFANKQD+  AM  +E+ + LGL +L+ R W I  T AT G GL E ++WL   + ++
Sbjct:    1 MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANALGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARD1_MOUSE (GTP-binding protein ARD-1 OS=Mus musculus GN=Trim23 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.003e-54
Identity = 102/164 (62.20%), Postives = 127/164 (77.44%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K E+R++ +GLD AGKTTIL+KLK  E +  IPTIGFNVETVEYKN+ FT+WDVGG+ K+RPLW+HY+ NTQ ++FVVDS+ RDR+ EA  EL ++L E ELRDA+LL+FANKQD+  A++  EIT+ L LH L   R WYIQ   A SG GLYEGLDWLS  +
Sbjct:  402 KMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQL 565          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARD1_HUMAN (GTP-binding protein ARD-1 OS=Homo sapiens GN=TRIM23 PE=1 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.003e-54
Identity = 102/164 (62.20%), Postives = 127/164 (77.44%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K E+R++ +GLD AGKTTIL+KLK  E +  IPTIGFNVETVEYKN+ FT+WDVGG+ K+RPLW+HY+ NTQ ++FVVDS+ RDR+ EA  EL ++L E ELRDA+LL+FANKQD+  A++  EIT+ L LH L   R WYIQ   A SG GLYEGLDWLS  +
Sbjct:  402 KMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQL 565          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF3_YEAST (ADP-ribosylation factor 3 OS=Saccharomyces cerevisiae GN=ARF3 PE=1 SV=2)

HSP 1 Score: 211.075 bits (536), Expect = 6.500e-54
Identity = 101/177 (57.06%), Postives = 135/177 (76.27%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLH-SLRQRHWYIQSTCATSGEGLYEGLDWLSNN 619
            MG S +K+  +LF  KEM+ILM+GLD AGKTTILYKLKL +I T+ PT+GFNVETV YKN+ F +WDVGGQ ++RPLWRHYF  T  LIFV+DS+ R+R+ EA++EL+ ++ E E+ + VLLV+ANKQDL +AM   E++D L L  +L+ + W +  + A SG+GL EGL W+SNN
Sbjct:    1 MGNSISKVLGKLFGSKEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWISNN 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL1_YEAST (ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae GN=ARL1 PE=1 SV=4)

HSP 1 Score: 210.69 bits (535), Expect = 8.489e-54
Identity = 101/174 (58.05%), Postives = 133/174 (76.44%), Query Frame = 2
Query:   92 MGLSFTKLFSRLF-AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            MG  F+ +F +L+ + KE+RIL++GLD AGKTTILY+L++GE+VTT PTIGFNVET+ YKN+   VWD+GGQ  IRP WR Y+ +T  +IFVVDS D+DR+  A  ELH ML E+EL+DA LLVFANKQD P A++A+E++ +L L  L+ R W I ++ A  GEG+ EGLDWL
Sbjct:    1 MGNIFSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWL 174          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARD1_RAT (GTP-binding protein ARD-1 (Fragment) OS=Rattus norvegicus GN=Trim23 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 8.489e-54
Identity = 101/164 (61.59%), Postives = 126/164 (76.83%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K E+R++ +GLD AGKTTIL+KLK  E +  IPTIGFNVETVEYKN+ FT+WDVG + K+RPLW+HY+ NTQ ++FVVDS+ RDR+ EA  EL ++L E ELRDA+LL+FANKQD+  A++  EIT+ L LH L   R WYIQ   A SG GLYEGLDWLS  +
Sbjct:  382 KMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGEKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQL 545          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL1_DROME (ADP-ribosylation factor-like protein 1 OS=Drosophila melanogaster GN=Arf72A PE=1 SV=5)

HSP 1 Score: 204.142 bits (518), Expect = 7.945e-52
Identity = 98/172 (56.98%), Postives = 126/172 (73.26%), Query Frame = 2
Query:  116 FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            F  L   +EMRIL++GLD AGKTTILY+L++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDR+  ++DEL  ML E+EL  A+L+V ANKQD+   M  AE+   LGL +L+ R + I  T AT GEGL + +DWLSN + ++
Sbjct:    8 FRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSR 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL1_CAEEL (ADP-ribosylation factor-like protein 1 OS=Caenorhabditis elegans GN=arl-1 PE=2 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 1.770e-51
Identity = 101/172 (58.72%), Postives = 123/172 (71.51%), Query Frame = 2
Query:  116 FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            F  LF  +EMRIL++GLD AGKTTILY+L++GE+VTTIPTIGFNVE VEYKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDRV  +R EL  ML EDEL+ AVL V ANKQD+   +   E+   LGL +LR R   I  T A+ GEGL   +DWL+N +  K
Sbjct:    8 FRGLFGAREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVEYKNLKFQVWDLGGQTSIRPYWRCYYANTDAIIYVVDSADRDRVGISRQELATMLQEDELQGAVLAVLANKQDIAGCLTETEVYKALGLDALRNRTIQIFKTSASKGEGLDPAMDWLANQLQQK 179          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARL1_BOVIN3.446e-5557.22ADP-ribosylation factor-like protein 1 OS=Bos taur... [more]
ARL1_RAT4.501e-5557.22ADP-ribosylation factor-like protein 1 OS=Rattus n... [more]
ARL1_MOUSE4.501e-5557.22ADP-ribosylation factor-like protein 1 OS=Mus musc... [more]
ARD1_MOUSE1.003e-5462.20GTP-binding protein ARD-1 OS=Mus musculus GN=Trim2... [more]
ARD1_HUMAN1.003e-5462.20GTP-binding protein ARD-1 OS=Homo sapiens GN=TRIM2... [more]
ARF3_YEAST6.500e-5457.06ADP-ribosylation factor 3 OS=Saccharomyces cerevis... [more]
ARL1_YEAST8.489e-5458.05ADP-ribosylation factor-like protein 1 OS=Saccharo... [more]
ARD1_RAT8.489e-5461.59GTP-binding protein ARD-1 (Fragment) OS=Rattus nor... [more]
ARL1_DROME7.945e-5256.98ADP-ribosylation factor-like protein 1 OS=Drosophi... [more]
ARL1_CAEEL1.770e-5158.72ADP-ribosylation factor-like protein 1 OS=Caenorha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top