CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL2_BOVIN (ADP-ribosylation factor-like protein 2 OS=Bos taurus GN=ARL2 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 8.805e-43
Identity = 81/166 (48.80%), Postives = 117/166 (70.48%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            ++E+R+LM+GLD AGKTTIL K    +I T  PT+GFN++T+E++     +WDVGGQ  +R  WR+YF++T GLI+VVDS DR R+ + + EL  +L E+ L  A LL+FANKQDLP A+++  I + L L S+R  HW IQ   A +GE L  G+DWL ++I+++
Sbjct:   14 ERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQNLLVEERLAGATLLIFANKQDLPGALSSNAIREALELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSR 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL2_HUMAN (ADP-ribosylation factor-like protein 2 OS=Homo sapiens GN=ARL2 PE=1 SV=4)

HSP 1 Score: 173.326 bits (438), Expect = 1.502e-42
Identity = 81/166 (48.80%), Postives = 117/166 (70.48%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            ++E+R+LM+GLD AGKTTIL K    +I T  PT+GFN++T+E++     +WDVGGQ  +R  WR+YF++T GLI+VVDS DR R+ + + EL  +L E+ L  A LL+FANKQDLP A+++  I + L L S+R  HW IQ   A +GE L  G+DWL ++I+++
Sbjct:   14 ERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSR 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL2_MOUSE (ADP-ribosylation factor-like protein 2 OS=Mus musculus GN=Arl2 PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.962e-42
Identity = 81/169 (47.93%), Postives = 117/169 (69.23%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA*T 640
            ++E+R+LM+GLD AGKTTIL K    ++ T  PT+GFN++T+E++     +WDVGGQ  +R  WR+YF++T GLI+VVDS DR R+ + + EL  +L E+ L  A LL+FANKQDLP A++   I + L L S+R  HW IQ   A +GE L  G+DWL ++I+++  T
Sbjct:   14 ERELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSRVFT 182          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL2_RAT (ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus GN=Arl2 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.707e-42
Identity = 80/169 (47.34%), Postives = 117/169 (69.23%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA*T 640
            ++++R+LM+GLD AGKTTIL K    ++ T  PT+GFN++T+E++     +WDVGGQ  +R  WR+YF++T GLI+VVDS DR R+ + + EL  +L E+ L  A LL+FANKQDLP A++   I + L L S+R  HW IQ   A +GE L  G+DWL ++I+++  T
Sbjct:   14 ERDVRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSRVFT 182          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL3_TAEGU (ADP-ribosylation factor-like protein 3 OS=Taeniopygia guttata GN=ARL3 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.169e-41
Identity = 81/165 (49.09%), Postives = 115/165 (69.70%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +E+RIL++GLD AGKTT+L +L   +I    PT GFN+++V+ +     VWD+GGQ KIRP WR+YF+NT  LI+V+DS DR R  E   EL  +L+E++L    +L+FANKQDL  A  A+EI + L LH++R R W IQS  A SGEG+ +G++W+  N++ K
Sbjct:   16 QEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALSGEGVQDGMNWVCKNVSTK 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL3_BOVIN (ADP-ribosylation factor-like protein 3 OS=Bos taurus GN=ARL3 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.076e-40
Identity = 80/165 (48.48%), Postives = 114/165 (69.09%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +E+RIL++GLD AGKTT+L +L   +I    PT GFN+++V+ +     VWD+GGQ KIRP WR+YF+NT  LI+V+DS DR R  E   EL  +L E++L    +L+FANKQDL  A  A+EI + L LH++R R W IQS  A +GEG+ +G++W+  N++ K
Sbjct:   16 QEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRFWQIQSCSALTGEGVQDGMNWVCKNVSAK 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL3_RAT (ADP-ribosylation factor-like protein 3 OS=Rattus norvegicus GN=Arl3 PE=1 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 2.398e-40
Identity = 82/165 (49.70%), Postives = 112/165 (67.88%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +E+RIL++GLD AGKTT+L +L   +I    PT GFN+++V+ +     VWD+GGQ KIRP WR YF+NT  LI+V+DS DR R  E   EL  +L E++L    +LVFANKQDL  A  AAEI + L LH++R R W IQS  A +GEG+ +G++W+  N+  K
Sbjct:   16 QEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLVFANKQDLLTAAPAAEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL3_XENLA (ADP-ribosylation factor-like protein 3 OS=Xenopus laevis GN=arl3 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 3.132e-40
Identity = 79/165 (47.88%), Postives = 114/165 (69.09%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +E+RIL++GLD AGKTT+L +L   +I    PT GFN+++V+ +     VWD+GGQ KIRP WR+YF+NT  LI+V+DS DR R  E   EL  +L+E++L    +L+FANKQDL  A  A+EI + L LH++R R W IQS  A +G+G+ +G++W+  N+  K
Sbjct:   16 QEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGQGVQDGMNWVCKNVNAK 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL3_PIG (ADP-ribosylation factor-like protein 3 OS=Sus scrofa GN=ARL3 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 4.090e-40
Identity = 80/165 (48.48%), Postives = 113/165 (68.48%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +E+RIL++GLD AGKTT+L +L   +I    PT GFN+++V+ +     VWD+GGQ KIRP WR+YF+NT  LI+V+DS DR R  E   EL  +L E++L    +L+FANKQDL  A  A+EI + L LH++R R W IQS  A +GEG+ +G++W+  N+  K
Sbjct:   16 QEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL3_MOUSE (ADP-ribosylation factor-like protein 3 OS=Mus musculus GN=Arl3 PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 6.977e-40
Identity = 80/165 (48.48%), Postives = 112/165 (67.88%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +E+RIL++GLD AGKTT+L +L   +I    PT GFN+++V+ +     VWD+GGQ KIRP WR YF+NT  LI+V+DS DR R  E   EL  +L E++L    +L+FANKQDL  A  A+EI + L LH++R R W IQS  A +GEG+ +G++W+  N+  K
Sbjct:   16 QEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK 180          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARL2_BOVIN8.805e-4348.80ADP-ribosylation factor-like protein 2 OS=Bos taur... [more]
ARL2_HUMAN1.502e-4248.80ADP-ribosylation factor-like protein 2 OS=Homo sap... [more]
ARL2_MOUSE1.962e-4247.93ADP-ribosylation factor-like protein 2 OS=Mus musc... [more]
ARL2_RAT5.707e-4247.34ADP-ribosylation factor-like protein 2 OS=Rattus n... [more]
ARL3_TAEGU2.169e-4149.09ADP-ribosylation factor-like protein 3 OS=Taeniopy... [more]
ARL3_BOVIN1.076e-4048.48ADP-ribosylation factor-like protein 3 OS=Bos taur... [more]
ARL3_RAT2.398e-4049.70ADP-ribosylation factor-like protein 3 OS=Rattus n... [more]
ARL3_XENLA3.132e-4047.88ADP-ribosylation factor-like protein 3 OS=Xenopus ... [more]
ARL3_PIG4.090e-4048.48ADP-ribosylation factor-like protein 3 OS=Sus scro... [more]
ARL3_MOUSE6.977e-4048.48ADP-ribosylation factor-like protein 3 OS=Mus musc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top