CK934293
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK934293 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.265e-14 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 3 Query: 6 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 116 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 474 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of CK934293 vs. ExPASy Swiss-Prot
Match: INO1_SPIPO (Inositol-3-phosphate synthase OS=Spirodela polyrrhiza GN=TUR1 PE=2 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.265e-14 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 3 Query: 6 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 116 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 474 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of CK934293 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.265e-14 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 3 Query: 6 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 116 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 474 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of CK934293 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.265e-14 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 3 Query: 6 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 116 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 474 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of CK934293 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.265e-14 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 3 Query: 6 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 116 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 476 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 512
BLAST of CK934293 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.265e-14 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 3 Query: 6 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 116 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 471 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 507
BLAST of CK934293 vs. ExPASy Swiss-Prot
Match: INO1_BRANA (Inositol-3-phosphate synthase OS=Brassica napus PE=2 SV=2) HSP 1 Score: 77.0258 bits (188), Expect = 3.265e-14 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 3 Query: 6 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 116 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 474 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of CK934293 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.265e-14 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 3 Query: 6 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 116 PGTPVVNALSKQRAMLEN+LRACVGLAPENNMILEYK Sbjct: 474 PGTPVVNALSKQRAMLENVLRACVGLAPENNMILEYK 510
BLAST of CK934293 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2) HSP 1 Score: 76.2554 bits (186), Expect = 5.570e-14 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 3 Query: 6 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 116 PGTPVVNALSKQRAMLENILRACVGLAPENNMI+EYK Sbjct: 474 PGTPVVNALSKQRAMLENILRACVGLAPENNMIMEYK 510
BLAST of CK934293 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2) HSP 1 Score: 75.0998 bits (183), Expect = 1.241e-13 Identity = 35/37 (94.59%), Postives = 37/37 (100.00%), Query Frame = 3 Query: 6 PGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 116 PGTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 474 PGTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510 The following BLAST results are available for this feature:
BLAST of CK934293 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 15
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK934293 ID=CK934293; Name=CK934293; organism=Citrus sinensis; type=EST; length=412bpback to top |