CK934303
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK934303 vs. ExPASy Swiss-Prot
Match: PSBK_ANAVT (Photosystem II reaction center protein K OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=psbK PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.619e-11 Identity = 29/43 (67.44%), Postives = 35/43 (81.40%), Query Frame = 2 Query: 236 SSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364 ++ L AKLPEAY +P+VDV+P+IPV F LLAFVWQAAV FR Sbjct: 3 AALLLAKLPEAYQIFDPLVDVLPIIPVFFLLLAFVWQAAVGFR 45
BLAST of CK934303 vs. ExPASy Swiss-Prot
Match: PSBK_ANASP (Photosystem II reaction center protein K OS=Anabaena sp. (strain PCC 7120) GN=psbK PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.619e-11 Identity = 29/43 (67.44%), Postives = 35/43 (81.40%), Query Frame = 2 Query: 236 SSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364 ++ L AKLPEAY +P+VDV+P+IPV F LLAFVWQAAV FR Sbjct: 3 AALLLAKLPEAYQIFDPLVDVLPIIPVFFLLLAFVWQAAVGFR 45 The following BLAST results are available for this feature:
BLAST of CK934303 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 82
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK934303 ID=CK934303; Name=CK934303; organism=Citrus sinensis; type=EST; length=424bpback to top |