EY756596
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY756596 vs. ExPASy Swiss-Prot
Match: IMK2_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 5.664e-12 Identity = 33/71 (46.48%), Postives = 51/71 (71.83%), Query Frame = 1 Query: 1 PRVRVDLPRWVRSVVREEWTAEVFDVELLK-YQDVEEEMVQMLQIALSCVAKVPDSRPKMDDVVRMIEQIQ 210 P +DLP+WV S+V+EEWT EVFD+EL++ Q V +E++ L++AL CV P +RP+ + VV +E+I+ Sbjct: 739 PTNGMDLPQWVASIVKEEWTNEVFDLELMRETQSVGDELLNTLKLALHCVDPSPAARPEANQVVEQLEEIR 809
BLAST of EY756596 vs. ExPASy Swiss-Prot
Match: Y3288_ARATH (Probable inactive receptor kinase At3g02880 OS=Arabidopsis thaliana GN=At3g02880 PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 7.397e-12 Identity = 31/66 (46.97%), Postives = 49/66 (74.24%), Query Frame = 1 Query: 13 VDLPRWVRSVVREEWTAEVFDVELLKYQ-DVEEEMVQMLQIALSCVAKVPDSRPKMDDVVRMIEQI 207 VDLPRWV+SV ++ ++V D EL +YQ + E ++++L+I +SC A+ PDSRP M +V R+IE++ Sbjct: 550 VDLPRWVQSVTEQQTPSDVLDPELTRYQPEGNENIIRLLKIGMSCTAQFPDSRPSMAEVTRLIEEV 615 The following BLAST results are available for this feature:
BLAST of EY756596 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY756596 ID=EY756596; Name=EY756596; organism=Citrus sinensis; type=EST; length=530bpback to top |