EY753353
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY753353 vs. ExPASy Swiss-Prot
Match: THIO_HELPY (Thioredoxin OS=Helicobacter pylori GN=trxA PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.931e-11 Identity = 31/90 (34.44%), Postives = 58/90 (64.44%), Query Frame = 1 Query: 127 TVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK 393 T E++ ++KG+A +VDF A WC PCK++SP++ ELA + KV+ DE + ++ ++ + ++PT + TK+G+V+ ++VG + Sbjct: 8 TEENFESTIKKGVA-----LVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTKDGEVVHQLVGVQ 92
BLAST of EY753353 vs. ExPASy Swiss-Prot
Match: THIO_HELPJ (Thioredoxin OS=Helicobacter pylori J99 GN=trxA PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.931e-11 Identity = 31/90 (34.44%), Postives = 58/90 (64.44%), Query Frame = 1 Query: 127 TVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK 393 T E++ ++KG+A +VDF A WC PCK++SP++ ELA + KV+ DE + ++ ++ + ++PT + TK+G+V+ ++VG + Sbjct: 8 TEENFESTIKKGVA-----LVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTKDGEVVHQLVGVQ 92
BLAST of EY753353 vs. ExPASy Swiss-Prot
Match: THIOM_RAT (Thioredoxin, mitochondrial OS=Rattus norvegicus GN=Txn2 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.931e-11 Identity = 34/83 (40.96%), Postives = 55/83 (66.27%), Query Frame = 1 Query: 181 IVVDFTASWCPPCKLMSPILSEL-AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEK 423 +VVDF A WC PCK++ P L ++ AK+ V+ KVD+D+ +A E+ V A+PT + K G V+++ VG K +D+L+ ++K Sbjct: 81 VVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDKFVGIKDEDQLEAFLKK 163
BLAST of EY753353 vs. ExPASy Swiss-Prot
Match: THIOM_MOUSE (Thioredoxin, mitochondrial OS=Mus musculus GN=Txn2 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.931e-11 Identity = 34/83 (40.96%), Postives = 55/83 (66.27%), Query Frame = 1 Query: 181 IVVDFTASWCPPCKLMSPILSEL-AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEK 423 +VVDF A WC PCK++ P L ++ AK+ V+ KVD+D+ +A E+ V A+PT + K G V+++ VG K +D+L+ ++K Sbjct: 81 VVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDKFVGIKDEDQLEAFLKK 163
BLAST of EY753353 vs. ExPASy Swiss-Prot
Match: THIOM_HUMAN (Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 2.931e-11 Identity = 34/83 (40.96%), Postives = 55/83 (66.27%), Query Frame = 1 Query: 181 IVVDFTASWCPPCKLMSPILSEL-AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEK 423 +VVDF A WC PCK++ P L ++ AK+ V+ KVD+D+ +A E+ V A+PT + K G V+++ VG K +D+L+ ++K Sbjct: 81 VVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKK 163
BLAST of EY753353 vs. ExPASy Swiss-Prot
Match: THIO_STAES (Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.828e-11 Identity = 35/102 (34.31%), Postives = 64/102 (62.75%), Query Frame = 1 Query: 127 TVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 426 T ++ +++ G+ +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 7 TDSDFDSKIESGVK-----LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGEPVDKVVGFQPKENLAEVLDKH 103
BLAST of EY753353 vs. ExPASy Swiss-Prot
Match: THIO_STAEQ (Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.828e-11 Identity = 35/102 (34.31%), Postives = 64/102 (62.75%), Query Frame = 1 Query: 127 TVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 426 T ++ +++ G+ +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 7 TDSDFDSKIESGVK-----LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGEPVDKVVGFQPKENLAEVLDKH 103
BLAST of EY753353 vs. ExPASy Swiss-Prot
Match: THIO_STAAW (Thioredoxin OS=Staphylococcus aureus (strain MW2) GN=trxA PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.828e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = 1 Query: 184 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 426 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of EY753353 vs. ExPASy Swiss-Prot
Match: THIO_STAAU (Thioredoxin OS=Staphylococcus aureus GN=trxA PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.828e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = 1 Query: 184 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 426 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of EY753353 vs. ExPASy Swiss-Prot
Match: THIO_STAAS (Thioredoxin OS=Staphylococcus aureus (strain MSSA476) GN=trxA PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.828e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = 1 Query: 184 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 426 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103 The following BLAST results are available for this feature:
BLAST of EY753353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 102
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY753353 ID=EY753353; Name=EY753353; organism=Citrus sinensis; type=EST; length=610bpback to top |