FE659184
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_HANAN (Cytochrome c OS=Hansenula anomala PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.142e-11 Identity = 29/45 (64.44%), Postives = 34/45 (75.56%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ K G +FKT+C QCHTVEKG HK GPNL+G+FGRQSG G Sbjct: 7 GSEKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRQSGKAEG 51
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_ASPNG (Cytochrome c OS=Aspergillus niger GN=cycA PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.142e-11 Identity = 28/46 (60.87%), Postives = 37/46 (80.43%), Query Frame = -1 Query: 2 PGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 139 PG++ G K+F+T+CAQCHTVE G HK GPNL+GLFGR++G + G Sbjct: 8 PGDSAKGAKLFQTRCAQCHTVEAGGPHKVGPNLHGLFGRKTGQSEG 53
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_ALLMI (Cytochrome c OS=Alligator mississippiensis PE=1 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 1.142e-11 Identity = 29/45 (64.44%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+KIF KCAQCHTVEKG HK GPNL+GL GR++G PG Sbjct: 2 GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLIGRKTGQAPG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_DRONO (Cytochrome c OS=Dromaius novae-hollandiae GN=CYC PE=1 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 1.492e-11 Identity = 29/45 (64.44%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+KIF KC+QCHTVEKG HK GPNLNGLFGR++G G Sbjct: 2 GDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLNGLFGRKTGQAEG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC2_XENTR (Cytochrome c, testis-specific OS=Xenopus tropicalis GN=cyct PE=3 SV=3) HSP 1 Score: 68.1662 bits (165), Expect = 1.492e-11 Identity = 29/45 (64.44%), Postives = 36/45 (80.00%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+A+ G+KIF KC+QCHTVEKG HK GPNL+GLFGR++G G Sbjct: 2 GDAEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_RAT (Cytochrome c, somatic OS=Rattus norvegicus GN=Cycs PE=1 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 1.948e-11 Identity = 29/45 (64.44%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+KIF KCAQCHTVEKG HK GPNL+GLFGR++G G Sbjct: 2 GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_MOUSE (Cytochrome c, somatic OS=Mus musculus GN=Cycs PE=1 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 1.948e-11 Identity = 29/45 (64.44%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+KIF KCAQCHTVEKG HK GPNL+GLFGR++G G Sbjct: 2 GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_HELAS (Cytochrome c OS=Helix aspersa PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.948e-11 Identity = 29/45 (64.44%), Postives = 33/45 (73.33%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G A+ G+KIF KC QCHTVE G HK GPNL+GLFGR+ G PG Sbjct: 1 GZAZKGKKIFTQKCLQCHTVEAGGKHKTGPNLSGLFGRKQGQAPG 45
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_RABIT (Cytochrome c OS=Oryctolagus cuniculus GN=CYCS PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 2.545e-11 Identity = 29/45 (64.44%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+KIF KCAQCHTVEKG HK GPNL+GLFGR++G G Sbjct: 2 GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVG 46
BLAST of FE659184 vs. ExPASy Swiss-Prot
Match: CYC_LAMGU (Cytochrome c OS=Lama guanicoe GN=CYCS PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 2.545e-11 Identity = 29/45 (64.44%), Postives = 35/45 (77.78%), Query Frame = -1 Query: 2 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPG 136 G+ + G+KIF KCAQCHTVEKG HK GPNL+GLFGR++G G Sbjct: 2 GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVG 46 The following BLAST results are available for this feature:
BLAST of FE659184 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 98
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FE659184 ID=FE659184; Name=FE659184; organism=Citrus sinensis; type=EST; length=178bpback to top |