FE659064
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE659064 vs. ExPASy Swiss-Prot
Match: CATH_MOUSE (Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 7.204e-14 Identity = 27/44 (61.36%), Postives = 37/44 (84.09%), Query Frame = 3 Query: 3 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV 134 G ++G+ YW++KNSWG WG++GYF +E GKNMCG+A CASYP+ Sbjct: 287 GEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPI 330
BLAST of FE659064 vs. ExPASy Swiss-Prot
Match: CATL1_CHICK (Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL1 PE=1 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.455e-11 Identity = 29/46 (63.04%), Postives = 32/46 (69.57%), Query Frame = 3 Query: 3 GVEDGVPYWLIKNSWGENWGDHGYFKMEMG-KNMCGIATCASYPVV 137 G E G YW++KNSWGE WGD GY M KN CGIAT ASYP+V Sbjct: 173 GFEGGKKYWIVKNSWGEKWGDKGYIYMAKDRKNHCGIATAASYPLV 218 The following BLAST results are available for this feature:
BLAST of FE659064 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FE659064 ID=FE659064; Name=FE659064; organism=Citrus sinensis; type=EST; length=246bpback to top |