EY720059
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY720059 vs. ExPASy Swiss-Prot
Match: THIO_STAA8 (Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.058e-12 Identity = 32/82 (39.02%), Postives = 55/82 (67.07%), Query Frame = 2 Query: 329 ITEITESEFPNTVLKSERPVLVEFVAN*CGPCRLVAPAVEWLAQEYGDRLTVVKIDHDANPQLIEEYKIYGMPTLILFKNGQ 574 I ++T+++F + V + LV+F A CGPC+++AP +E LA +Y + ++K+D D NP +Y++ +PTLI+FK+GQ Sbjct: 3 IVKVTDADFDSKVESGVQ--LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQ 82
BLAST of EY720059 vs. ExPASy Swiss-Prot
Match: THIO_STAA3 (Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.058e-12 Identity = 32/82 (39.02%), Postives = 55/82 (67.07%), Query Frame = 2 Query: 329 ITEITESEFPNTVLKSERPVLVEFVAN*CGPCRLVAPAVEWLAQEYGDRLTVVKIDHDANPQLIEEYKIYGMPTLILFKNGQ 574 I ++T+++F + V + LV+F A CGPC+++AP +E LA +Y + ++K+D D NP +Y++ +PTLI+FK+GQ Sbjct: 3 IVKVTDADFDSKVESGVQ--LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQ 82
BLAST of EY720059 vs. ExPASy Swiss-Prot
Match: THIO_HAEIN (Thioredoxin OS=Haemophilus influenzae GN=trxA PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.058e-12 Identity = 30/84 (35.71%), Postives = 56/84 (66.67%), Query Frame = 2 Query: 323 SGITEITESEFPNTVLKSERPVLVEFVAN*CGPCRLVAPAVEWLAQEYGDRLTVVKIDHDANPQLIEEYKIYGMPTLILFKNGQ 574 S + I +++F + V+ S+ P+L++F A CGPC+++AP ++ LA E+ ++ +VK++ D N ++ + +PTL+L KNGQ Sbjct: 2 SEVLHINDADFESVVVNSDIPILLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNVDDNQATPAQFGVRSIPTLLLIKNGQ 85
BLAST of EY720059 vs. ExPASy Swiss-Prot
Match: THIO1_SYNY3 (Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803) GN=slr0233 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 9.058e-12 Identity = 32/76 (42.11%), Postives = 48/76 (63.16%), Query Frame = 2 Query: 347 SEFPNTVLKSERPVLVEFVAN*CGPCRLVAPAVEWLAQEYGDRLTVVKIDHDANPQLIEEYKIYGMPTLILFKNGQ 574 + F + S +PVLV+F A CGPC+++AP +E + ++ VVKID D P + +Y+I +PTL+LFK GQ Sbjct: 8 ANFAEMLAGSPKPVLVDFYATWCGPCQMMAPILEQVGSHLRQQIQVVKIDTDKYPAIATQYQIQSLPTLVLFKQGQ 83
BLAST of EY720059 vs. ExPASy Swiss-Prot
Match: THIO_CHLLT (Thioredoxin OS=Chlorobium limicola f.sp. thiosulfatophilum GN=trxA PE=1 SV=5) HSP 1 Score: 70.4774 bits (171), Expect = 1.545e-11 Identity = 29/80 (36.25%), Postives = 50/80 (62.50%), Query Frame = 2 Query: 335 EITESEFPNTVLKSERPVLVEFVAN*CGPCRLVAPAVEWLAQEYGDRLTVVKIDHDANPQLIEEYKIYGMPTLILFKNGQ 574 E T+ F +L S++ VLV+F A+ CGPC ++ P +E LA +Y + + K++ D NP + +Y I +PT+++ K G+ Sbjct: 6 EATDKNFQTEILDSDKAVLVDFWASWCGPCMMLGPVIEQLADDYEGKAIIAKLNVDENPNIAGQYGIRSIPTMLIIKGGK 85
BLAST of EY720059 vs. ExPASy Swiss-Prot
Match: THIO1_CHLTE (Thioredoxin-1 OS=Chlorobium tepidum GN=trx1 PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 2.636e-11 Identity = 31/67 (46.27%), Postives = 46/67 (68.66%), Query Frame = 2 Query: 374 SERPVLVEFVAN*CGPCRLVAPAVEWLAQEYGDRLTVVKIDHDANPQLIEEYKIYGMPTLILFKNGQ 574 SE PV ++F A+ CGPC++VAP+V+ LA E+ RL VVK++ D P +++ G+P L+LF GQ Sbjct: 12 SELPVFIDFWADWCGPCKMVAPSVKQLASEFKGRLIVVKVNVDQQPDAAARFQVQGIPALMLFVGGQ 78
BLAST of EY720059 vs. ExPASy Swiss-Prot
Match: THIO_STAS1 (Thioredoxin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trxA PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.442e-11 Identity = 30/82 (36.59%), Postives = 53/82 (64.63%), Query Frame = 2 Query: 329 ITEITESEFPNTVLKSERPVLVEFVAN*CGPCRLVAPAVEWLAQEYGDRLTVVKIDHDANPQLIEEYKIYGMPTLILFKNGQ 574 I ++T+S F + + LV+F A CGPC+++AP +E LA +Y + ++K+D D NP ++++ +PTLI+FK+G+ Sbjct: 3 IVKVTDSNFDDNIQSGVN--LVDFWATWCGPCKMIAPVLEELAGDYDGKANILKLDVDENPSTAAKFEVMSIPTLIVFKDGE 82
BLAST of EY720059 vs. ExPASy Swiss-Prot
Match: THIO_STAHJ (Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.442e-11 Identity = 30/82 (36.59%), Postives = 53/82 (64.63%), Query Frame = 2 Query: 329 ITEITESEFPNTVLKSERPVLVEFVAN*CGPCRLVAPAVEWLAQEYGDRLTVVKIDHDANPQLIEEYKIYGMPTLILFKNGQ 574 I ++T+S F + + LV+F A CGPC+++AP +E LA +Y + ++K+D D NP ++++ +PTLI+FK+G+ Sbjct: 3 IVKVTDSNFDENIQSGVK--LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKFEVMSIPTLIVFKDGE 82
BLAST of EY720059 vs. ExPASy Swiss-Prot
Match: THIO2_CORNE (Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3) HSP 1 Score: 69.3218 bits (168), Expect = 3.442e-11 Identity = 32/85 (37.65%), Postives = 51/85 (60.00%), Query Frame = 2 Query: 320 SSGITEITESEFPNTVLKSERPVLVEFVAN*CGPCRLVAPAVEWLAQEYGDRLTVVKIDHDANPQLIEEYKIYGMPTLILFKNGQ 574 S+ I T+ F VL +E PVLV+F A C PC+ +AP +E L+ EY ++ +VK+D + +Y I +P L++FK+G+ Sbjct: 2 SATIVNTTDENFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEELSNEYAGKVKIVKVDVTSCEDTAVKYNIRNIPALLMFKDGE 86
BLAST of EY720059 vs. ExPASy Swiss-Prot
Match: THIO_BACSU (Thioredoxin OS=Bacillus subtilis GN=trxA PE=1 SV=3) HSP 1 Score: 68.9366 bits (167), Expect = 4.496e-11 Identity = 37/87 (42.53%), Postives = 55/87 (63.22%), Query Frame = 2 Query: 329 ITEITESEFPNTVLKSERPVLVEFVAN*CGPCRLVAPAVEWLAQEYGDRLTVVKIDHDANPQLIEEYKIYGMPTLILFKNGQ--ETS 583 I + T+ F + SE VL +F A CGPC+++AP +E L QE GD+L +VKID D N + +Y + +PTL++ K+G+ ETS Sbjct: 3 IVKATDQSF--SAETSEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETS 87 The following BLAST results are available for this feature:
BLAST of EY720059 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 74
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY720059 ID=EY720059; Name=EY720059; organism=Citrus sinensis; type=EST; length=919bpback to top |