EY711199
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY711199 vs. ExPASy Swiss-Prot
Match: PROF3_TOBAC (Profilin-3 OS=Nicotiana tabacum GN=PRO3 PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 1.437e-11 Identity = 32/46 (69.57%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 82 MSWQTYVDDHLMCDIDGH--HLTSAAIVGHDGSVWAQSSNFPQVIP 213 MSWQTYVDDHLM D +G HL +AAI+GHDGSVWAQS +FP+ P Sbjct: 1 MSWQTYVDDHLMVDFEGQGQHLAAAAILGHDGSVWAQSPHFPKFKP 46
BLAST of EY711199 vs. ExPASy Swiss-Prot
Match: PROF2_TOBAC (Profilin-2 OS=Nicotiana tabacum GN=PRO2 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.876e-11 Identity = 32/47 (68.09%), Postives = 39/47 (82.98%), Query Frame = 1 Query: 82 MSWQTYVDDHLMCDIDG---HHLTSAAIVGHDGSVWAQSSNFPQVIP 213 MSWQTYVDDHLM DI+G +HL +AAI+G+DGSVWAQS+ FP+ P Sbjct: 1 MSWQTYVDDHLMADIEGQQGNHLAAAAILGNDGSVWAQSTTFPKFKP 47 The following BLAST results are available for this feature:
BLAST of EY711199 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY711199 ID=EY711199; Name=EY711199; organism=Citrus sinensis; type=EST; length=875bpback to top |