EY710670
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY710670 vs. ExPASy Swiss-Prot
Match: RBS_BATOE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Batophora oerstedii GN=RBCS PE=2 SV=2) HSP 1 Score: 63.5438 bits (153), Expect = 1.378e-14 Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 1 Query: 151 SNG--GRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEF 306 SNG + + M VW P K FET SYLPPL+D+ + K+++Y++R+ W PCLEF Sbjct: 26 SNGTISKSRAMMVWEPFNNKFFETFSYLPPLTDDQITKQVDYILRNNWTPCLEF 79 HSP 2 Score: 37.7354 bits (86), Expect = 1.378e-14 Identity = 21/59 (35.59%), Postives = 28/59 (47.46%), Query Frame = 2 Query: 356 YYDGRYWTMWKAGPCMGAQMQPQVLKEVGGGSKRKTHFHSSEIIGIENKDVQVAGDQFH 532 Y D RYWTMWK P G QVL E+ +K + + N+ VQ++G H Sbjct: 102 YQDNRYWTMWKL-PMFGCIDGSQVLTEISACTKAFPDAYIRLVCFDANRQVQISGFLVH 159
BLAST of EY710670 vs. ExPASy Swiss-Prot
Match: RBS3_ACECL (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Acetabularia cliftonii GN=RBCS-3 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 7.084e-11 Identity = 43/117 (36.75%), Postives = 56/117 (47.86%), Query Frame = 1 Query: 106 FPATKKTNNDITSIASNGGRVQC--MKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEK----------GMGVP*APQVTRILRWTLLDNVESWPMYGCTDAT 420 FP K N ASN +C M VW P K FET SYLPPL+DE + K+++Y++ + W PCLEF MG P + WT+ PM+GCTD + Sbjct: 22 FPRATKNNK---GFASNAAVQKCRDMMVWQPFNNKMFETFSYLPPLTDEQISKQVDYILANSWTPCLEFAASDQAYAGNENCIRMG-PVSSTYQDNRYWTMW----KLPMFGCTDGS 130 The following BLAST results are available for this feature:
BLAST of EY710670 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 92
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY710670 ID=EY710670; Name=EY710670; organism=Citrus sinensis; type=EST; length=1043bpback to top |