EY710499
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY710499 vs. ExPASy Swiss-Prot
Match: RBS2_THIFE (Ribulose bisphosphate carboxylase small chain 2 OS=Thiobacillus ferrooxidans GN=cbbS2 PE=3 SV=1) HSP 1 Score: 49.6766 bits (117), Expect = 9.849e-11 Identity = 23/61 (37.70%), Postives = 32/61 (52.46%), Query Frame = 1 Query: 217 KFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWK 399 KFETLSYLP L+ + + +++ Y++ GW P +E H P G YW MWK Sbjct: 18 KFETLSYLPALTADEIRQQVAYIVSKGWNPAVE------------HTEPENAFGNYWYMWK 66 HSP 2 Score: 38.5058 bits (88), Expect = 9.849e-11 Identity = 17/44 (38.64%), Postives = 24/44 (54.55%), Query Frame = 3 Query: 405 PCMGAQNATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFI 536 P G + +LKE K PH+ VRI+G+DN +Q Q S + Sbjct: 68 PMFGETDVDTILKEAERCHKRNPHNHVRIVGYDNFKQSQGTSLV 111 The following BLAST results are available for this feature:
BLAST of EY710499 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 111
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY710499 ID=EY710499; Name=EY710499; organism=Citrus sinensis; type=EST; length=969bpback to top |