EY685214
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY685214 vs. ExPASy Swiss-Prot
Match: UBCD1_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=eff PE=1 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 8.464e-17 Identity = 39/49 (79.59%), Postives = 42/49 (85.71%), Query Frame = 3 Query: 12 VSKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAM 158 +SKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY AR WT+KYAM Sbjct: 99 ISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM 147
BLAST of EY685214 vs. ExPASy Swiss-Prot
Match: UBC5_YEAST (Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae GN=UBC5 PE=1 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 2.463e-16 Identity = 38/49 (77.55%), Postives = 44/49 (89.80%), Query Frame = 3 Query: 12 VSKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAM 158 +SKVLLSICSLLTD NPDDPLVPEIA +YKTD+ KYE TA+ WT+KYA+ Sbjct: 100 LSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYAV 148
BLAST of EY685214 vs. ExPASy Swiss-Prot
Match: UB2D1_MOUSE (Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 4.201e-16 Identity = 38/49 (77.55%), Postives = 42/49 (85.71%), Query Frame = 3 Query: 12 VSKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAM 158 VSKVLLSICSLL DPNPDDPLVP+IA +YK+D+ KY AR WTQKYAM Sbjct: 99 VSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147
BLAST of EY685214 vs. ExPASy Swiss-Prot
Match: UB2D1_HUMAN (Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 4.201e-16 Identity = 38/49 (77.55%), Postives = 42/49 (85.71%), Query Frame = 3 Query: 12 VSKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAM 158 VSKVLLSICSLL DPNPDDPLVP+IA +YK+D+ KY AR WTQKYAM Sbjct: 99 VSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147
BLAST of EY685214 vs. ExPASy Swiss-Prot
Match: UB2D1_BOVIN (Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus GN=UBE2D1 PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 4.201e-16 Identity = 38/49 (77.55%), Postives = 42/49 (85.71%), Query Frame = 3 Query: 12 VSKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAM 158 VSKVLLSICSLL DPNPDDPLVP+IA +YK+D+ KY AR WTQKYAM Sbjct: 99 VSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147 The following BLAST results are available for this feature:
BLAST of EY685214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 35
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY685214 ID=EY685214; Name=EY685214; organism=Citrus sinensis; type=EST; length=451bpback to top |