EY744400
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY744400 vs. ExPASy Swiss-Prot
Match: MTHR2_SCHPO (Methylenetetrahydrofolate reductase 2 OS=Schizosaccharomyces pombe GN=met11 PE=2 SV=2) HSP 1 Score: 73.9442 bits (180), Expect = 1.427e-12 Identity = 34/86 (39.53%), Postives = 52/86 (60.47%), Query Frame = 1 Query: 13 PFISFMAVNKEGNWKANVNQTDVNAVTWGVFRAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVHSSYYLV 270 P +++ A N + + N + +AVTWGV+ +EIIQ T++ SFK W E+F++W WA+LY + SRKLLE + +LV Sbjct: 536 PQVTYYAGNNKSEFLTNAPKDGASAVTWGVYPGREIIQSTIIAEVSFKAWLSESFQVWG-EWANLYSKNTPSRKLLENCINDRWLV 620
BLAST of EY744400 vs. ExPASy Swiss-Prot
Match: MTHR1_YEAST (Methylenetetrahydrofolate reductase 1 OS=Saccharomyces cerevisiae GN=MET12 PE=1 SV=2) HSP 1 Score: 73.1738 bits (178), Expect = 2.434e-12 Identity = 34/83 (40.96%), Postives = 49/83 (59.04%), Query Frame = 1 Query: 22 SFMAVNKEGNWKANVNQTDVNAVTWGVFRAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVHSSYYLV 270 S+ A + G+++ N++ + VTWGVF + Q T+++ SFK W+DEAF IWS WA L+P + LL VH Y LV Sbjct: 555 SYYAGDSSGSFETNLDPHSSSVVTWGVFPNSPVKQTTIIEEESFKAWRDEAFSIWS-EWAKLFPRNTPANILLRLVHKDYCLV 636 The following BLAST results are available for this feature:
BLAST of EY744400 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY744400 ID=EY744400; Name=EY744400; organism=Citrus sinensis; type=EST; length=930bpback to top |