EY744217
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_OLIPU (50S ribosomal protein L16, chloroplastic OS=Olimarabidopsis pumila GN=rpl16 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.592e-12 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G++ G +SRGN ICFGRYALQTL P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_NASOF (50S ribosomal protein L16, chloroplastic OS=Nasturtium officinale GN=rpl16 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.592e-12 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G++ G +SRGN ICFGRYALQTL P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_LOBMA (50S ribosomal protein L16, chloroplastic OS=Lobularia maritima GN=rpl16 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.592e-12 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G++ G +SRGN ICFGRYALQTL P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_DRANE (50S ribosomal protein L16, chloroplastic OS=Draba nemorosa GN=rpl16 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.592e-12 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G++ G +SRGN ICFGRYALQTL P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_CRUWA (50S ribosomal protein L16, chloroplastic OS=Crucihimalaya wallichii GN=rpl16 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.592e-12 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G++ G +SRGN ICFGRYALQTL P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_CAPBU (50S ribosomal protein L16, chloroplastic OS=Capsella bursa-pastoris GN=rpl16 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.592e-12 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G++ G +SRGN ICFGRYALQTL P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_BARVE (50S ribosomal protein L16, chloroplastic OS=Barbarea verna GN=rpl16 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.592e-12 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G++ G +SRGN ICFGRYALQTL P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_ARATH (50S ribosomal protein L16, chloroplastic OS=Arabidopsis thaliana GN=rpl16 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.592e-12 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G++ G +SRGN ICFGRYALQTL P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_ARAHI (50S ribosomal protein L16, chloroplastic OS=Arabis hirsuta GN=rpl16 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.592e-12 Identity = 38/72 (52.78%), Postives = 47/72 (65.28%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G++ G +SRGN ICFGRYALQTL P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_CERDE (50S ribosomal protein L16, chloroplastic OS=Ceratophyllum demersum GN=rpl16 PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 7.303e-12 Identity = 38/72 (52.78%), Postives = 46/72 (63.89%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G +SRGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGISSRGNRICFGRYALQALE-PAWITSRQIEAGRRAMTRYAR-RGGKIWVRIFPDK 72 The following BLAST results are available for this feature:
BLAST of EY744217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 58
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY744217 ID=EY744217; Name=EY744217; organism=Citrus sinensis; type=EST; length=951bpback to top |