EY744217
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_STAPU (50S ribosomal protein L16, chloroplastic OS=Staurastrum punctulatum GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 6.182e-11 Identity = 34/73 (46.58%), Postives = 47/73 (64.38%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEKT 749 +P + +H+G++ G A+RGN ICFGR+ALQ L P QIE G +AM R + RG K W+RIFP+K+ Sbjct: 3 SPRRTKYRKQHRGRLKGTATRGNRICFGRFALQALE-PSWITSRQIEAGRRAMTRYAR-RGGKLWIRIFPDKS 73
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_LIRTU (50S ribosomal protein L16, chloroplastic OS=Liriodendron tulipifera GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 6.182e-11 Identity = 37/71 (52.11%), Postives = 44/71 (61.97%), Query Frame = 3 Query: 534 PNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 P F +H+G+M G + RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 2 PKRTRFRKQHRGRMKGISYRGNHICFGRYALQALE-PAWITSRQIEAGRRAMTRYAR-RGGKIWVRIFPDK 70
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_CUCSA (50S ribosomal protein L16, chloroplastic OS=Cucumis sativus GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 6.182e-11 Identity = 36/72 (50.00%), Postives = 44/72 (61.11%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F H+G+M G + RGN ICFGRYA+Q L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKHHRGRMKGISYRGNSICFGRYAIQALE-PAWITSRQIEAGRRAMTRNAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_CHLSC (50S ribosomal protein L16, chloroplastic OS=Chloranthus spicatus GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 6.182e-11 Identity = 37/71 (52.11%), Postives = 44/71 (61.97%), Query Frame = 3 Query: 534 PNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 P F +H+G+M G + RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 5 PKRTRFRKQHRGRMKGISYRGNNICFGRYALQALE-PAWITSRQIEAGRRAMTRYAR-RGGKIWVRIFPDK 73
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_CALFG (50S ribosomal protein L16, chloroplastic OS=Calycanthus floridus var. glaucus GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 6.182e-11 Identity = 37/72 (51.39%), Postives = 45/72 (62.50%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G + RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGISYRGNHICFGRYALQALE-PSWITSRQIEAGRRAMTRYAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_IPOPU (50S ribosomal protein L16, chloroplastic OS=Ipomoea purpurea GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 8.074e-11 Identity = 36/72 (50.00%), Postives = 45/72 (62.50%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 +P F +H+G+M G +S GN ICFG+YALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 3 SPKRTRFRKQHRGRMKGISSGGNHICFGKYALQALE-PAWITSRQIEAGRRAMTRNAR-RGGKIWVRIFPDK 72
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_CRYJA (50S ribosomal protein L16, chloroplastic OS=Cryptomeria japonica GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 8.074e-11 Identity = 40/91 (43.96%), Postives = 56/91 (61.54%), Query Frame = 3 Query: 531 APNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK---TPPGQSRR---KPKGA 785 +P F ++H+G++ G +SRGN ICFGR+ALQ L P+ QIE G +A+ R + RG K W+RIFP+K T P + R K KG+ Sbjct: 3 SPKRTKFRHQHRGRIKGISSRGNRICFGRFALQALE-PVWITSGQIEAGRRAITRYAR-RGVKIWIRIFPDKPIRTRPAEIRMGSGKAKGS 91
BLAST of EY744217 vs. ExPASy Swiss-Prot
Match: RK16_CITSI (50S ribosomal protein L16, chloroplastic OS=Citrus sinensis GN=rpl16 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 8.074e-11 Identity = 37/71 (52.11%), Postives = 44/71 (61.97%), Query Frame = 3 Query: 534 PNE*SFPNKHKGKMTGKASRGNLICFGRYALQTLRTPLGSKPEQIETGPQAMVRKGKPRGEKFWVRIFPEK 746 P F +H+G+M G + RGN ICFGRYALQ L P QIE G +AM R + RG K WVRIFP+K Sbjct: 5 PKRTRFRKQHRGRMKGISYRGNHICFGRYALQALE-PAWITSRQIEAGRRAMTRNVR-RGGKIWVRIFPDK 73 The following BLAST results are available for this feature:
BLAST of EY744217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 58
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY744217 ID=EY744217; Name=EY744217; organism=Citrus sinensis; type=EST; length=951bpback to top |