EY744211
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY744211 vs. ExPASy Swiss-Prot
Match: ARR11_ARATH (Two-component response regulator ARR11 OS=Arabidopsis thaliana GN=ARR11 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 1.643e-11 Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = 1 Query: 421 DEPARTLKRPRLVWTPQLHKRFVDAVAHLGIKN-AVPKTIMQLMSVDGLTRENVASHLQKYRLYLKK 618 D + + K+ R+VW+ +LH +FV+AV +G + A PK I+ LM+V LTRENVASHLQKYRLYL + Sbjct: 185 DPSSSSSKKARVVWSFELHHKFVNAVNQIGCDHKAGPKKILDLMNVPWLTRENVASHLQKYRLYLSR 251
BLAST of EY744211 vs. ExPASy Swiss-Prot
Match: ARR13_ARATH (Putative two-component response regulator ARR13 OS=Arabidopsis thaliana GN=ARR13 PE=2 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 6.244e-11 Identity = 32/73 (43.84%), Postives = 47/73 (64.38%), Query Frame = 1 Query: 400 GSGGAGGDEPARTLKRPRLVWTPQLHKRFVDAVAHLGIKNAVPKTIMQLMSVDGLTRENVASHLQKYRLYLKK 618 G G+ ++ K+ ++ WT L F+ A+ H+G VPK I+ +M+V LTRENVASHLQKYRL++K+ Sbjct: 210 GGPSDDGESLSQPPKKKKIWWTNPLQDLFLQAIQHIGYDKVVPKKILAIMNVPYLTRENVASHLQKYRLFVKR 282 The following BLAST results are available for this feature:
BLAST of EY744211 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY744211 ID=EY744211; Name=EY744211; organism=Citrus sinensis; type=EST; length=956bpback to top |