EY659499

Overview
NameEY659499
Unique NameEY659499
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7556 contig Csv1_Contig7556:60..983. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA5_RAT (Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.309e-26
Identity = 79/217 (36.41%), Postives = 123/217 (56.68%), Query Frame = 1
Query:   70 ADDVVVL-TEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIG-KVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRST-EALAEYVNNEGGTNVKIAAVP-----SNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAF--ALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK 687
            A DVV + +E +F + +  +++  L+ FYAPWC  CK++ P ++K  A+  +  +VL G  V   E +++  +Y V+GYPTI +F KG     +YE   ST E + E++ N      ++   P      +V  LT ++FD+ V + S  VLV F+APWCGHCK + P +E  A       E   V+A +DA   + LAE++ +S FPTLK+F  G +
Sbjct:  148 AKDVVHIDSEKDFRRLLKKEEKPLLMMFYAPWCSMCKRIMPHFQK-AATQVRGHTVLAGMNVYPPEFENIKEEYNVRGYPTICYFEKGRF-LFQYENYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHS-SVLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATINEALAERFHISAFPTLKYFKNGEQ 361          

HSP 2 Score: 119.398 bits (298), Expect = 2.916e-26
Identity = 76/235 (32.34%), Postives = 118/235 (50.21%), Query Frame = 1
Query:   88 LTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASF--KKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGG---TNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDA--DKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCGTSRDG 771
            LT+++F++ V +    LV F+APWCGHCKK+ PE+E            S ++  VD   +++L  ++ +  +PT+++F  G  E +     R+ +   E++ N               ++V+ L  DNF E  L K K  LV FYAPWC HCK + P +   A AF  +  +  A +D   DK +DL ++  V  +PT  ++  G K  E+Y   R    F SFI     T R+G
Sbjct:  279 LTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATINEALAERFHISAFPTLKYFKNG--EQQAVPALRTKKKFIEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRE-TLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQESVKAYPTFHYYHYG-KLVEKYESDRTELGFTSFIR----TLREG 505          

HSP 3 Score: 75.8702 bits (185), Expect = 3.697e-13
Identity = 36/104 (34.62%), Postives = 57/104 (54.81%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDC--DEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYV 384
            V+ L  DNF + + + +  LV FYAPWC HCKK+ P +     +FK  + +    VDC  D+++ LC +  V+ YPT  ++  G L  +KYE  R+      ++
Sbjct:  397 VLHLVGDNFRETLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQESVKAYPTFHYYHYGKL-VEKYESDRTELGFTSFI 499          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDI1_SCHPO (Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe GN=SPAC1F5.02 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.309e-26
Identity = 63/133 (47.37%), Postives = 92/133 (69.17%), Query Frame = 1
Query:  361 TEALAEYVNNEGGTNVKIAAVPSN---VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK-DGEEYGGGRYLEDFVSFINE 747
            T+ + ++V+ +    +K   +P +   +VVL ADNFD+IV+D++KDVLVEFYAPWCGHCKNLAPTYEK+A  ++ + +VVVA +DA +  D++    +SGFPT+ FF    K +   Y G R LED  +FI++
Sbjct:  330 TKFVGDFVDGKLQPKIKSQPIPESQEDLVVLVADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLAEEYSDDSNVVVAKIDATE-NDIS--VSISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFIDK 459          

HSP 2 Score: 101.293 bits (251), Expect = 8.217e-21
Identity = 69/202 (34.16%), Postives = 107/202 (52.97%), Query Frame = 1
Query:   76 DVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDV-LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPK 678
            +V  + ++   + +  D+  +V+FYAPWCGHCK LAPEYE      +K   + + +VDC E   LCS+Y ++GYPT+  F  G  +  +Y GPR  +AL +Y+  +    VK  +        T +NF    ++K+ D+ +V F+       + L  TY +VA    ++DD V A   A   K+LA+  G S FP +  F K
Sbjct:   23 EVPKVNKEGLNELITADKVLMVKFYAPWCGHCKALAPEYESAADELEK-DGISLVEVDCTEEGDLCSEYSIRGYPTLNVFKNGK-QISQYSGPRKHDALVKYMRKQLLPTVKPISKD------TLENF----VEKADDLAVVAFFKD-----QKLNDTYTEVAE--VMKDDFVFA---ASDDKELAKSLG-SNFPGIVAFTK 201          

HSP 3 Score: 91.2781 bits (225), Expect = 8.504e-18
Identity = 45/107 (42.06%), Postives = 66/107 (61.68%), Query Frame = 1
Query:   73 DDVVVLTEDNFEKEV-GQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWF-PKGSLEPKKYEGPRSTEALAEYVN 387
            +D+VVL  DNF+  V  + +  LVEFYAPWCGHCK LAP YEKL   +    +V++ K+D  E+    S   + G+PTI +F     + P +YEG R+ E L+ +++
Sbjct:  355 EDLVVLVADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLAEEYSDDSNVVVAKIDATENDISVS---ISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFID 458          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA5_BOVIN (Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.233e-26
Identity = 76/216 (35.19%), Postives = 120/216 (55.56%), Query Frame = 1
Query:   70 ADDVVVL-TEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIG-KVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVP-----SNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDV--VVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK 687
            A DVV +  E +F + +  +++  L+ FYAPWC  CK++ P ++K  A+  + + VL G  V   E +++  +Y V+GYPTI +F KG    +      + E + E++ N      ++   P      +V  L+ ++FD+ V + S  VLV F+APWCGHCK + P +E  A     E D   V+A +DA   K LAE++ ++ FPTLK+F  G K
Sbjct:  152 AKDVVHIDNEKDFRRLLKKEEKPILMMFYAPWCSVCKRIMPHFQK-AATQLRGQFVLAGMNVYPSEFENIKEEYSVRGYPTICYFEKGRFLFQYDSYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLSDEDFDQFVKEHS-SVLVMFHAPWCGHCKKMKPEFESAAEVLHGEGDSSGVLAAVDATVNKALAERFHIAEFPTLKYFKNGEK 365          

HSP 2 Score: 115.931 bits (289), Expect = 3.224e-25
Identity = 76/237 (32.07%), Postives = 121/237 (51.05%), Query Frame = 1
Query:   88 LTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASF--KKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGP--RSTEALAEYVNNEGGTNVKIAA---VPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDA--DKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCGTSRDG 771
            L++++F++ V +    LV F+APWCGHCKK+ PE+E        +   S ++  VD   +K+L  ++ +  +PT+++F  G    +KY  P  R+ ++  E++ N         A     ++V+ L+ DNF E  L + K  LV FYAPWC HCK   P +   A AF  +  +  A +D   +  KDL ++  V  +PT  ++  G K  E+Y        F SFI     T R+G
Sbjct:  283 LSDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFESAAEVLHGEGDSSGVLAAVDATVNKALAERFHIAEFPTLKYFKNG----EKYAVPALRTKKSFIEWMRNPESPPPPDPAWEEQQTSVLHLSGDNFRE-TLKRKKHALVMFYAPWCPHCKKAIPHFTAAADAFKDDRKIACAAIDCVKENNKDLCQQEAVKAYPTFHYYHYG-KFVEKYDTNPTELGFTSFIR----TLREG 509          

HSP 3 Score: 71.633 bits (174), Expect = 6.973e-12
Identity = 33/94 (35.11%), Postives = 50/94 (53.19%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDC--DEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGP 354
            V+ L+ DNF + + + + ALV FYAPWC HCKK  P +     +FK  + +    +DC  + +K LC +  V+ YPT  ++  G    K    P
Sbjct:  401 VLHLSGDNFRETLKRKKHALVMFYAPWCPHCKKAIPHFTAAADAFKDDRKIACAAIDCVKENNKDLCQQEAVKAYPTFHYYHYGKFVEKYDTNP 494          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA5_MOUSE (Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.808e-26
Identity = 75/235 (31.91%), Postives = 118/235 (50.21%), Query Frame = 1
Query:   88 LTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASF--KKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGG---TNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDA--DKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCGTSRDG 771
            LT+++F++ V +    LV F+APWCGHCKK+ PE+E            S ++  VD   +++L  ++ +  +PT+++F  G  E +     R+ +   E++ N               ++V+ L  DNF +  L K K  LV FYAPWC HCK + P +   A AF  +  +  A +D   DK +DL ++  V  +PT  ++  G K  E+Y   R    F SFI     T R+G
Sbjct:  279 LTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATVNEALAGRFHISAFPTLKYFKNG--EQQAVPALRTKKKFIEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRD-TLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKEDRKIACAAVDCVKDKNQDLCQQEAVKAYPTFHYYHYG-KLVEKYESDRTELGFTSFIR----TLREG 505          

HSP 2 Score: 116.701 bits (291), Expect = 1.890e-25
Identity = 80/218 (36.70%), Postives = 122/218 (55.96%), Query Frame = 1
Query:   70 ADDVVVL-TEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIG-KVDCDEHKSLCSKYGVQGYPTIQWFPKGS-LEPKKYEGPRST-EALAEYVNNEGGTNVKIAAVP-----SNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAF--ALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK 687
            A DVV + +E +F + +  +++  L+ FYAPWC  CK++ P ++K  A+  +   VL G  V   E +++  +Y V+GYPTI +F KG  L P  YE   ST E + E++ N      ++   P      +V  LT ++FD+ V + S  VLV F+APWCGHCK + P +E  A       E   V+A +DA   + LA ++ +S FPTLK+F  G +
Sbjct:  148 AKDVVHIDSEKDFRRLLKREEKPLLMMFYAPWCSMCKRIMPHFQK-AATQVRGHIVLAGMNVYPSEFENIKEEYNVRGYPTICYFEKGRFLFP--YENYGSTAEDIVEWLKNPLPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHS-SVLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATVNEALAGRFHISAFPTLKYFKNGEQ 361          

HSP 3 Score: 75.8702 bits (185), Expect = 3.697e-13
Identity = 36/104 (34.62%), Postives = 57/104 (54.81%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDC--DEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYV 384
            V+ L  DNF   + + +  LV FYAPWC HCKK+ P +     +FK+ + +    VDC  D+++ LC +  V+ YPT  ++  G L  +KYE  R+      ++
Sbjct:  397 VLHLVGDNFRDTLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKEDRKIACAAVDCVKDKNQDLCQQEAVKAYPTFHYYHYGKL-VEKYESDRTELGFTSFI 499          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA3_BOVIN (Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.224e-25
Identity = 67/191 (35.08%), Postives = 100/191 (52.36%), Query Frame = 1
Query:    7 IERYQIWLALSTLTLFFVSALADDVVVLTEDNFEKEV---GQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKS-------KDVLVEFYAPWCGHCKNLAPTY 549
            + R  ++  L+ L      A A DV+ LT+DNFE  +   G     LVEF+APWCGHCKKLAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G        P++V + + + F++ + DK        KD+  E ++ +     NL   Y
Sbjct:    3 LRRLALFPGLALLLAAARLAAASDVLELTDDNFESRITDTGSSGLMLVEFFAPWCGHCKKLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-ESGAYDGPRTADGIVSHLKKQAG--------PASVPLKSEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRDNY 182          

HSP 2 Score: 108.227 bits (269), Expect = 6.722e-23
Identity = 55/140 (39.29%), Postives = 83/140 (59.29%), Query Frame = 1
Query:  346 EGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDG-EEYGGGRYLEDFVSFINEK 750
            +G      L +Y +      +K   +P +    V V+ A+NFDEIV +++KDVL+EFYAPWCGHCKNL P Y+++      + ++V+A +DA    D+   Y V GFPT+ F P   K   ++Y GGR L DF+S++  +
Sbjct:  345 DGKALERFLEDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLRKDPNIVIAKMDATA-NDVPSPYEVRGFPTIYFSPANKKQNPKKYEGGRELSDFISYLKRE 483          

HSP 3 Score: 93.9745 bits (232), Expect = 1.312e-18
Identity = 52/115 (45.22%), Postives = 68/115 (59.13%), Query Frame = 1
Query:  418 AVPSNVVVLTADNFDEIVLDKSKD--VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            A  S+V+ LT DNF+  + D      +LVEF+APWCGHCK LAP YE  AAA  L+  V +A +D     +   KYGVSG+PTLK F  G + G  Y G R  +  VS + ++ G
Sbjct:   22 AAASDVLELTDDNFESRITDTGSSGLMLVEFFAPWCGHCKKLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEESG-AYDGPRTADGIVSHLKKQAG 133          

HSP 4 Score: 87.8113 bits (216), Expect = 9.402e-17
Identity = 43/107 (40.19%), Postives = 66/107 (61.68%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLE-PKKYEGPRSTEALAEYVNNE 393
            V V+  +NF++ V  +++  L+EFYAPWCGHCK L P+Y++LG   +K  +++I K+D   +  + S Y V+G+PTI + P    + PKKYEG R       Y+  E
Sbjct:  378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLRKDPNIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKQNPKKYEGGRELSDFISYLKRE 483          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA3_RAT (Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 4.210e-25
Identity = 65/167 (38.92%), Postives = 91/167 (54.49%), Query Frame = 1
Query:   13 RYQIWLALSTLTLFFVSAL---ADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVL 495
            R+     L  + L   SAL   A DV+ LT++NFE  V     A   LVEF+APWCGHCK+LAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G        P++V + T D F + + DK   V+
Sbjct:    2 RFSCLALLPGVALLLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-EAGAYDGPRTADGIVSHLKKQAG--------PASVPLRTEDEFKKFISDKDASVV 157          

HSP 2 Score: 104.375 bits (259), Expect = 9.707e-22
Identity = 54/140 (38.57%), Postives = 81/140 (57.86%), Query Frame = 1
Query:  346 EGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK-DGEEYGGGRYLEDFVSFINEK 750
            +G      L EY +      +K   +P      V V+ A++FD+IV  + KDVL+EFYAPWCGHCKNL P Y+++    + + ++V+A +DA    D+   Y V GFPT+ F P   K   ++Y GGR L DF+S++  +
Sbjct:  345 DGKALERFLQEYFDGNLKRYLKSEPIPETNEGPVKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATA-NDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQRE 483          

HSP 3 Score: 90.5077 bits (223), Expect = 1.450e-17
Identity = 52/117 (44.44%), Postives = 69/117 (58.97%), Query Frame = 1
Query:  412 IAAVPSNVVVLTADNFDEIVLDKSKD--VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            + A  S+V+ LT +NF+  V D      +LVEF+APWCGHCK LAP YE  AAA  L+  V +A +D     +   KYGVSG+PTLK F  G + G  Y G R  +  VS + ++ G
Sbjct:   20 LLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG-AYDGPRTADGIVSHLKKQAG 133          

HSP 4 Score: 87.4261 bits (215), Expect = 1.228e-16
Identity = 44/107 (41.12%), Postives = 64/107 (59.81%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNE 393
            V V+  ++F+  V  +D+  L+EFYAPWCGHCK L P+Y++LG    K  +++I K+D   +  + S Y V+G+PTI + P    L PKKYEG R       Y+  E
Sbjct:  378 VKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQRE 483          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA3_CERAE (Protein disulfide-isomerase A3 OS=Cercopithecus aethiops GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 7.182e-25
Identity = 74/207 (35.75%), Postives = 106/207 (51.21%), Query Frame = 1
Query:   64 ALADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFP 675
            A A DV+ LT+DNFE  V     A   LVEF+APWCGHCK+LAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G        P++V + T + F + + DK   V V F+        +     E + AA  L D+   A+ +    K L  +Y  +G   + F P
Sbjct:   22 AAASDVLELTDDNFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-EAGAYDGPRTADGIVSHLKKQAG--------PASVPLRTEEEFKKFISDKDASV-VGFFDDLFSEAHS-----EFLKAASNLRDNYRFAHTNV---KSLVNEYDDNGEGIILFRP 208          

HSP 2 Score: 108.612 bits (270), Expect = 5.147e-23
Identity = 55/140 (39.29%), Postives = 85/140 (60.71%), Query Frame = 1
Query:  346 EGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK-DGEEYGGGRYLEDFVSFINEK 750
            +G      L +Y +      +K   +P +    V V+ A+NFDEIV +++KDVL+EFYAPWCGHCKNL P Y+++    + + ++V+A +DA    D+   Y V GFPT+ F P   K + ++Y GGR L DF+S++  +
Sbjct:  345 DGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATA-NDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQRE 483          

HSP 3 Score: 92.4337 bits (228), Expect = 3.817e-18
Identity = 53/115 (46.09%), Postives = 68/115 (59.13%), Query Frame = 1
Query:  418 AVPSNVVVLTADNFDEIVLDKSKD--VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            A  S+V+ LT DNF+  V D      +LVEF+APWCGHCK LAP YE  AAA  L+  V +A +D     +   KYGVSG+PTLK F  G + G  Y G R  +  VS + ++ G
Sbjct:   22 AAASDVLELTDDNFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG-AYDGPRTADGIVSHLKKQAG 133          

HSP 4 Score: 88.5817 bits (218), Expect = 5.512e-17
Identity = 44/107 (41.12%), Postives = 65/107 (60.75%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNE 393
            V V+  +NF++ V  +++  L+EFYAPWCGHCK L P+Y++LG    K  +++I K+D   +  + S Y V+G+PTI + P    L PKKYEG R       Y+  E
Sbjct:  378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQRE 483          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA3_PONAB (Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.090e-24
Identity = 58/147 (39.46%), Postives = 84/147 (57.14%), Query Frame = 1
Query:   64 ALADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVL 495
            A A DV+ LT+DNFE  +     A   LVEF+APWCGHCK+LAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G        P++V + T + F + + DK   ++
Sbjct:   22 AAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-EAGAYDGPRTADGIVSHLKKQAG--------PASVPLRTEEEFKKFISDKDASIV 157          

HSP 2 Score: 108.612 bits (270), Expect = 5.147e-23
Identity = 55/140 (39.29%), Postives = 85/140 (60.71%), Query Frame = 1
Query:  346 EGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK-DGEEYGGGRYLEDFVSFINEK 750
            +G      L +Y +      +K   +P +    V V+ A+NFDEIV +++KDVL+EFYAPWCGHCKNL P Y+++    + + ++V+A +DA    D+   Y V GFPT+ F P   K + ++Y GGR L DF+S++  +
Sbjct:  345 DGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATA-NDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQRE 483          

HSP 3 Score: 92.0485 bits (227), Expect = 4.985e-18
Identity = 52/115 (45.22%), Postives = 68/115 (59.13%), Query Frame = 1
Query:  418 AVPSNVVVLTADNFDEIVLDKSKD--VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            A  S+V+ LT DNF+  + D      +LVEF+APWCGHCK LAP YE  AAA  L+  V +A +D     +   KYGVSG+PTLK F  G + G  Y G R  +  VS + ++ G
Sbjct:   22 AAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG-AYDGPRTADGIVSHLKKQAG 133          

HSP 4 Score: 88.5817 bits (218), Expect = 5.512e-17
Identity = 44/107 (41.12%), Postives = 65/107 (60.75%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNE 393
            V V+  +NF++ V  +++  L+EFYAPWCGHCK L P+Y++LG    K  +++I K+D   +  + S Y V+G+PTI + P    L PKKYEG R       Y+  E
Sbjct:  378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQRE 483          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA3_HUMAN (Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4)

HSP 1 Score: 113.235 bits (282), Expect = 2.090e-24
Identity = 58/147 (39.46%), Postives = 84/147 (57.14%), Query Frame = 1
Query:   64 ALADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVL 495
            A A DV+ LT+DNFE  +     A   LVEF+APWCGHCK+LAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G        P++V + T + F + + DK   ++
Sbjct:   22 AAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-EAGAYDGPRTADGIVSHLKKQAG--------PASVPLRTEEEFKKFISDKDASIV 157          

HSP 2 Score: 108.612 bits (270), Expect = 5.147e-23
Identity = 55/140 (39.29%), Postives = 85/140 (60.71%), Query Frame = 1
Query:  346 EGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK-DGEEYGGGRYLEDFVSFINEK 750
            +G      L +Y +      +K   +P +    V V+ A+NFDEIV +++KDVL+EFYAPWCGHCKNL P Y+++    + + ++V+A +DA    D+   Y V GFPT+ F P   K + ++Y GGR L DF+S++  +
Sbjct:  345 DGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATA-NDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQRE 483          

HSP 3 Score: 92.0485 bits (227), Expect = 4.985e-18
Identity = 52/115 (45.22%), Postives = 68/115 (59.13%), Query Frame = 1
Query:  418 AVPSNVVVLTADNFDEIVLDKSKD--VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            A  S+V+ LT DNF+  + D      +LVEF+APWCGHCK LAP YE  AAA  L+  V +A +D     +   KYGVSG+PTLK F  G + G  Y G R  +  VS + ++ G
Sbjct:   22 AAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG-AYDGPRTADGIVSHLKKQAG 133          

HSP 4 Score: 88.5817 bits (218), Expect = 5.512e-17
Identity = 44/107 (41.12%), Postives = 65/107 (60.75%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNE 393
            V V+  +NF++ V  +++  L+EFYAPWCGHCK L P+Y++LG    K  +++I K+D   +  + S Y V+G+PTI + P    L PKKYEG R       Y+  E
Sbjct:  378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQRE 483          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA3_CHICK (Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.729e-24
Identity = 77/235 (32.77%), Postives = 121/235 (51.49%), Query Frame = 1
Query:   34 LSTLTLFFVSALADDVVVLTEDNFEKEVGQDRG-ALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVS 735
            L  + L  +SA A DVV L++ +FE  + +  G  LVEF+APWCGHCK+LAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G        P++V + +  +F++ + DK   V V F+    G   +     E + AA  L D+   A+   ++   L +KY   G   + + P    +  E    +Y ED ++
Sbjct:   12 LLLVPLLALSAGASDVVELSDADFESGLAERPGLVLVEFFAPWCGHCKRLAPEYEAAATRLKGI--VPLVKVDCTANSNTCNKYGVSGYPTLKIFRDGE-ESGTYDGPRTADGIVSHLKKQAG--------PASVALSSVADFEKFIGDKDASV-VGFFRDASGDAYS-----EFMKAANNLRDNYRFAHTSEEQ---LVQKYEEDGEGVVLYRPSRLANKFEDSTVKYTEDKIT 226          

HSP 2 Score: 110.923 bits (276), Expect = 1.037e-23
Identity = 57/140 (40.71%), Postives = 83/140 (59.29%), Query Frame = 1
Query:  346 EGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDG-EEYGGGRYLEDFVSFINEK 750
            +G      L +Y +      +K   VP N    V V+ A+NFDEIV  + KDVL+EFYAPWCGHCKNL P Y+++    + + ++V+A +DA    D+   Y V GFPT+ F P G K   ++Y GGR + DF+S++  +
Sbjct:  343 DGKALERFLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATA-NDVPSPYEVRGFPTIYFAPAGKKQSPKKYEGGREVSDFISYLKRE 481          

HSP 3 Score: 91.6633 bits (226), Expect = 6.511e-18
Identity = 45/107 (42.06%), Postives = 66/107 (61.68%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLE-PKKYEGPRSTEALAEYVNNE 393
            V V+  +NF++ V  +D+  L+EFYAPWCGHCK L P+Y++LG    K  +++I K+D   +  + S Y V+G+PTI + P G  + PKKYEG R       Y+  E
Sbjct:  376 VKVVVAENFDEIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVRGFPTIYFAPAGKKQSPKKYEGGREVSDFISYLKRE 481          

HSP 4 Score: 89.3521 bits (220), Expect = 3.231e-17
Identity = 49/115 (42.61%), Postives = 69/115 (60.00%), Query Frame = 1
Query:  412 IAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            ++A  S+VV L+  +F+  + ++   VLVEF+APWCGHCK LAP YE  AAA  L+  V +  +D     +   KYGVSG+PTLK F  G + G  Y G R  +  VS + ++ G
Sbjct:   20 LSAGASDVVELSDADFESGLAERPGLVLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLVKVDCTANSNTCNKYGVSGYPTLKIFRDGEESG-TYDGPRTADGIVSHLKKQAG 131          
The following BLAST results are available for this feature:
BLAST of EY659499 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 87
Match NameE-valueIdentityDescription
PDIA5_RAT1.309e-2636.41Protein disulfide-isomerase A5 OS=Rattus norvegicu... [more]
PDI1_SCHPO1.309e-2647.37Putative protein disulfide-isomerase C1F5.02 OS=Sc... [more]
PDIA5_BOVIN2.233e-2635.19Protein disulfide-isomerase A5 OS=Bos taurus GN=PD... [more]
PDIA5_MOUSE3.808e-2631.91Protein disulfide-isomerase A5 OS=Mus musculus GN=... [more]
PDIA3_BOVIN3.224e-2535.08Protein disulfide-isomerase A3 OS=Bos taurus GN=PD... [more]
PDIA3_RAT4.210e-2538.92Protein disulfide-isomerase A3 OS=Rattus norvegicu... [more]
PDIA3_CERAE7.182e-2535.75Protein disulfide-isomerase A3 OS=Cercopithecus ae... [more]
PDIA3_PONAB2.090e-2439.46Protein disulfide-isomerase A3 OS=Pongo abelii GN=... [more]
PDIA3_HUMAN2.090e-2439.46Protein disulfide-isomerase A3 OS=Homo sapiens GN=... [more]
PDIA3_CHICK2.729e-2432.77Protein disulfide-isomerase A3 OS=Gallus gallus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-G10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659499 ID=EY659499|Name=EY659499|organism=Citrus sinensis|type=EST|length=922bp
ANAGATATTGAGAGGTATCAGATCTGGCTAGCTCTCAGCACTTTAACCTT
GTTCTTCGTATCAGCTCTAGCGGACGATGTCGTTGTGCTAACAGAAGACA
ACTTCGAGAAGGAGGTTGGTCAGGACAGGGGAGCTCTTGTTGAGTTTTAC
GCTCCTTGGTGTGGCCACTGTAAAAAGCTTGCTCCAGAGTATGAGAAACT
TGGTGCAAGCTTTAAGAAAGCAAAGTCTGTCTTGATTGGAAAGGTGGACT
GTGACGAGCATAAGAGCTTATGCAGCAAATATGGTGTTCAAGGATACCCA
ACAATTCAATGGTTTCCTAAAGGTTCTTTGGAACCCAAAAAGTATGAAGG
GCCACGATCTACTGAAGCCCTTGCTGAGTATGTGAATAATGAAGGAGGAA
CCAATGTGAAGATAGCTGCAGTCCCATCCAATGTGGTGGTACTAACAGCT
GATAATTTTGATGAGATAGTTTTGGACAAAAGCAAAGATGTTTTGGTTGA
ATTTTATGCACCATGGTGTGGCCATTGCAAAAACCTTGCGCCTACATATG
AAAAGGTGGCAGCCGCATTTGCATTGGAAGATGATGTAGTCGTTGCTAAT
TTGGATGCTGACAAATACAAGGATCTGGCTGAGAAGTATGGAGTTAGTGG
ATTTCCTACATTGAAGTTCTTTCCAAAAGGGCACAAAGATGGTGAGGAAT
ATGGGGGTGGCAGATATTTGGAAGACTTTGTTTCTTTCATCAATGAAAAA
TGTGGCACCAGTCGTGATGGAAAAGGACAACTTACTTCAACGGNGGTATA
GTTGCGAGCTTAAAGCCTNGGTGAAAGGATTTGTTGCTGCTACCGGTGAT
GAAAAAAGGCAGTCTTCTCAANATTGACCGGGAGTTTGAGTGCTTGAGGC
TCCACTGCGGCATGGGAAGATT
back to top