EY659357

Overview
NameEY659357
Unique NameEY659357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length869
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6052 contig Csv1_Contig6052:357..1226. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_SULIY (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=flpA PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.236e-31
Identity = 79/185 (42.70%), Postives = 110/185 (59.46%), Query Frame = 2
Query:  302 LVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVKTCNRS 853
            L T+NLV+G  VY E+ I  +      VEYR WN FRSKLA A+L G+    I+ G +VLYLGAASGTT+SHVSDI+  NG  Y VEFS R  R+   +A++R N+ P++ DAR P  Y+ +V  VD ++ D+A PDQ  I       F K+   +LL +  +    T     ++++EV+    S
Sbjct:   27 LCTRNLVSGFNVYGERLIKYEG-----VEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNARFFLKVNGYMLLVIKARSIDVTKDPKEIYKAEVEKLENS 206          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_SULIN (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=flpA PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.236e-31
Identity = 79/185 (42.70%), Postives = 110/185 (59.46%), Query Frame = 2
Query:  302 LVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVKTCNRS 853
            L T+NLV+G  VY E+ I  +      VEYR WN FRSKLA A+L G+    I+ G +VLYLGAASGTT+SHVSDI+  NG  Y VEFS R  R+   +A++R N+ P++ DAR P  Y+ +V  VD ++ D+A PDQ  I       F K+   +LL +  +    T     ++++EV+    S
Sbjct:   27 LCTRNLVSGFNVYGERLIKYEG-----VEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNARFFLKVNGYMLLVIKARSIDVTKDPKEIYKAEVEKLENS 206          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_SULIM (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=flpA PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.236e-31
Identity = 79/185 (42.70%), Postives = 110/185 (59.46%), Query Frame = 2
Query:  302 LVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVKTCNRS 853
            L T+NLV+G  VY E+ I  +      VEYR WN FRSKLA A+L G+    I+ G +VLYLGAASGTT+SHVSDI+  NG  Y VEFS R  R+   +A++R N+ P++ DAR P  Y+ +V  VD ++ D+A PDQ  I       F K+   +LL +  +    T     ++++EV+    S
Sbjct:   27 LCTRNLVSGFNVYGERLIKYEG-----VEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNARFFLKVNGYMLLVIKARSIDVTKDPKEIYKAEVEKLENS 206          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_SULIL (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=flpA PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.236e-31
Identity = 79/185 (42.70%), Postives = 110/185 (59.46%), Query Frame = 2
Query:  302 LVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVKTCNRS 853
            L T+NLV+G  VY E+ I  +      VEYR WN FRSKLA A+L G+    I+ G +VLYLGAASGTT+SHVSDI+  NG  Y VEFS R  R+   +A++R N+ P++ DAR P  Y+ +V  VD ++ D+A PDQ  I       F K+   +LL +  +    T     ++++EV+    S
Sbjct:   27 LCTRNLVSGFNVYGERLIKYEG-----VEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNARFFLKVNGYMLLVIKARSIDVTKDPKEIYKAEVEKLENS 206          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_SULIK (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=flpA PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.236e-31
Identity = 79/185 (42.70%), Postives = 110/185 (59.46%), Query Frame = 2
Query:  302 LVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVKTCNRS 853
            L T+NLV+G  VY E+ I  +      VEYR WN FRSKLA A+L G+    I+ G +VLYLGAASGTT+SHVSDI+  NG  Y VEFS R  R+   +A++R N+ P++ DAR P  Y+ +V  VD ++ D+A PDQ  I       F K+   +LL +  +    T     ++++EV+    S
Sbjct:   27 LCTRNLVSGFNVYGERLIKYEG-----VEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNARFFLKVNGYMLLVIKARSIDVTKDPKEIYKAEVEKLENS 206          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_SULIA (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=flpA PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.236e-31
Identity = 79/185 (42.70%), Postives = 110/185 (59.46%), Query Frame = 2
Query:  302 LVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVKTCNRS 853
            L T+NLV+G  VY E+ I  +      VEYR WN FRSKLA A+L G+    I+ G +VLYLGAASGTT+SHVSDI+  NG  Y VEFS R  R+   +A++R N+ P++ DAR P  Y+ +V  VD ++ D+A PDQ  I       F K+   +LL +  +    T     ++++EV+    S
Sbjct:   27 LCTRNLVSGFNVYGERLIKYEG-----VEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNARFFLKVNGYMLLVIKARSIDVTKDPKEIYKAEVEKLENS 206          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_STAMF (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=flpA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.614e-31
Identity = 84/204 (41.18%), Postives = 121/204 (59.31%), Query Frame = 2
Query:  242 VVVEPH-RHEGVFIAKGKEDA--LVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVKT 841
            V ++PH ++ GV+I + ++ +  L TKNLV G  VY E+      E     EYR WN +RSKLA A+  G+    I+ G  +LYLG A+GTT SH+SDIVGP G +++VEF+ R  R+F  +A  R N+ PI+ DAR P  YR LV MVD I++D+A P+QA I+      F K    +LL +  +    T     +++ E+ T
Sbjct:    5 VNIKPHEKYYGVYIVELEDGSVKLATKNLVPGHRVYGERLYRWGGE-----EYREWNLYRSKLAGALANGLAEQPIREGHSILYLGVATGTTASHISDIVGPTGRIFSVEFAPRVMREFVLVADIRKNLYPILGDARKPKEYRHLVEMVDGIYADIAQPEQAAIVADNADYFLKDNGYLLLAIKARSIDVTKEPSEIYRREINT 203          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_METVS (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=flpA PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 8.009e-31
Identity = 73/142 (51.41%), Postives = 95/142 (66.90%), Query Frame = 2
Query:  302 LVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARIL 727
            + TK+L  G+ VY EK I  +N+     EYRIWNP +SKL AA++ G+  + IK G +VLYLGA++GTT SHVSDI   + +VYAVEF+ R  R+F     +R N+IPI+ DA  P  Y  +VG VD IF DVA P+QA IL
Sbjct:   25 IATKSLAPGKRVYGEKLIYSENK-----EYRIWNPNKSKLGAAIINGLKKMPIKKGTKVLYLGASAGTTPSHVSDI-SEDTIVYAVEFAPRIMREFIDSCNERINLIPILGDANRPFEYSNIVGKVDVIFEDVAQPNQAEIL 160          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_METM5 (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=flpA PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 9.732e-31
Identity = 68/142 (47.89%), Postives = 94/142 (66.20%), Query Frame = 2
Query:  302 LVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARIL 727
            + TK+L+ G+ VY EK +   N     +EYR+WNP +SKL AA++ G+  + IK G +VLYLGA++GTT SHV+DI   N +VYA+EF+ R  R+F     +R N+IP++ DA  P  Y  +V  VD IF DVA P+QA IL
Sbjct:   25 IATKSLIPGKRVYGEKLVYSDN-----IEYRVWNPNKSKLGAAIINGLKKMPIKKGTKVLYLGASAGTTPSHVADI-AENSLVYALEFAPRIMREFIDSCNERKNLIPVLGDANRPQDYSNIVEKVDVIFEDVAQPNQAEIL 160          

HSP 2 Score: 22.3274 bits (46), Expect = 9.732e-31
Identity = 10/22 (45.45%), Postives = 14/22 (63.64%), Query Frame = 1
Query:  718 EDFTPDASYFLKAGGHFVISIK 783
            E    +A +FLK  G+ +ISIK
Sbjct:  158 EILVKNAKWFLKENGYAMISIK 179          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_SULTO (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus tokodaii GN=flpA PE=3 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 1.267e-30
Identity = 74/141 (52.48%), Postives = 89/141 (63.12%), Query Frame = 2
Query:  302 LVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARI 724
            L TKNL  G +VY E+   V+      VEYR WN FRSKL  A+L G+    I  G +VLYLGAASGTT SHVSDIV   G VY VEFS R  R+F  +A+ R N+ PI+ DAR P  YR LV  VD ++ D+A PD+  I
Sbjct:   27 LCTKNLAPGFSVYGERLFKVEG-----VEYREWNAFRSKLGGAILKGLKQNPIVKGTKVLYLGAASGTTPSHVSDIVELEGKVYGVEFSPRVVREFLLVAQHRPNLFPILADARFPQYYRTLVEDVDVLYVDIAQPDETDI 162          

HSP 2 Score: 22.7126 bits (47), Expect = 1.267e-30
Identity = 8/17 (47.06%), Postives = 14/17 (82.35%), Query Frame = 1
Query:  733 DASYFLKAGGHFVISIK 783
            +A +FLK GG+ +++IK
Sbjct:  166 NAKFFLKNGGYMMMAIK 182          
The following BLAST results are available for this feature:
BLAST of EY659357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
FLPA_SULIY1.236e-3142.70Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_SULIN1.236e-3142.70Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_SULIM1.236e-3142.70Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_SULIL1.236e-3142.70Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_SULIK1.236e-3142.70Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_SULIA1.236e-3142.70Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_STAMF1.614e-3141.18Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_METVS8.009e-3151.41Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_METM59.732e-3147.89Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_SULTO1.267e-3052.48Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-C06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659357 ID=EY659357|Name=EY659357|organism=Citrus sinensis|type=EST|length=869bp
CCACGCGTCCGCTTTGTAGCCGGACAGAGCATCAAACATGAGACCTCCAA
GAGGACGCGGTGGTGGCGGTGGGTTCAGGGGAGGCAGAGGTGATGGAGGA
GGAAGAGGAAGAGGTGGCGGCCGAGGTGGTGGAGGTGGAAGAGGTGGTGG
TAGCGCTATGAGAGGCCGAGGTGGCGGTCGTGGCGGTGGCCGAGGTGGAG
GAAGAGGACGCGGTGGTGGAGGAATGAAGGGTGGAAGCAAGGTTGTAGTT
GAGCCTCATAGACACGAAGGAGTGTTCATTGCCAAGGGCAAAGAAGACGC
CCTTGTCACTAAGAATCTCGTCGCCGGTGAGGCTGTCTACAATGAGAAGA
GGATCTCCGTCCAGAATGAAGATGGAACCAAAGTTGAGTATAGAATTTGG
AATCCCTTCCGTTCCAAATTAGCTGCAGCTGTTCTTGGTGGTGTTGATAA
TATTTGGATTAAACCTGGTGTTAGGGTTCTATACCTTGGTGCTGCTTCCG
GCACAACTGTCTCACATGTTTCGGACATTGTTGGCCCTAATGGAGTAGTT
TATGCAGTGGAATTTTCTCATAGAAGTGGTAGAGACTTTGGTCATATGGC
AAAGAAGAGAACCAATGTTATACCCATAATTNGAGATGCTAGACATCCTG
CCNAGTACCGTATGTTGGTCGGTATGGTAGATTGTATATTTTCTGACGTT
GCCCCACCGGATCAGGCGAGGATTTTACCCCTGATGCATCATATTTTCTC
AAAGCTGGAGGTCATTTTGTTATTTCTATCAAGGAAACTGCATAGATTCA
CCTGTTCTGCTGGAGCAGTGTTCCAGAGTGAAGTTAAGACCTGCAACAGG
TCATTCCAACCCTTGAGCA
back to top