EY659338

Overview
NameEY659338
Unique NameEY659338
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: RPK1_IPONI (Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.545e-27
Identity = 85/276 (30.80%), Postives = 126/276 (45.65%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNK------------------------LSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +++F+G IP+T+G L+NL  L L  N                +   L  +  TGN LNG +PS+IGN+S  L TL++ +   SG +P S+G                G +P T   L+ L  L +  N LVG+ P +     ++D + L  N+                        LSG IPSC   LT L +LYL  N F+  IP      K ++      N L G +  ++G L  L  ++L  NNLSG++P +I  ++ LQ + L  N L G
Sbjct:  125 SNSFTGNIPDTLGALQNLRNLSLFFN-----SLIGPFPESLLSIPHLETVYFTGNGLNGSIPSNIGNMS-ELTTLWLDDNQFSGPVPSSLGNITTLQELYLNDNNLVGTLPVTLNNLENLVYLDVRNNSLVGAIPLDFVSCKQIDTISLSNNQFTGGLPPGLGNCTSLREFGAFSCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGELGMLSQLQYLHLYTNNLSGEVPLSIWKIQSLQSLQLYQNNLSG 394          

HSP 2 Score: 114.775 bits (286), Expect = 7.175e-25
Identity = 86/273 (31.50%), Postives = 129/273 (47.25%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKL-----VLFG-------------------NKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            F+G IP  +G   +LE L L  N                + KKL+ + L  N L G +PS +G  S +L+ L +   ++ G +P  +                TGPIP + G L+ +  +YL+ N+L GS P EL  L +L+ L     +L G                   N L+GSIPS L +LT L  L LG N F+  IP++ +    +L      N L G +   +G L+ L  +NLS N L+G +P  +G LK L+ +D+++N L G
Sbjct:  416 FTGVIPQDLGANSSLEVLDLTRNMFTGHIPPNL-----CSQKKLKRLLLGYNYLEGSVPSDLGGCS-TLERLILEENNLRGGLPDFV-EKQNLLFFDLSGNNFTGPIPPSLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGILPSELSNCHKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLNLQLGGNLLAGDI-PPVGALQALRSLNLSSNKLNGQLPIDLGKLKMLEELDVSHNNLSG 680          

HSP 3 Score: 113.62 bits (283), Expect = 1.598e-24
Identity = 65/212 (30.66%), Postives = 108/212 (50.94%), Query Frame = 2
Query:  128 ANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            ++ K L+ + L+GN   G +PS +GN S+ L+ + + + S +GNIP ++G                GP P +   +  L+ +Y   N L GS P  + ++  L  L L  N+ SG +PS L N+T+L+ LYL  N     +P T  +L+++++ D  +N LVG +  D  + K +  I+LS N  +G +P  +G    L+        L GP
Sbjct:   89 SHLKHLKKVVLSGNGFFGSIPSQLGNCSL-LEHIDLSSNSFTGNIPDTLGALQNLRNLSLFFNSLIGPFPESLLSIPHLETVYFTGNGLNGSIPSNIGNMSELTTLWLDDNQFSGPVPSSLGNITTLQELYLNDNNLVGTLPVTLNNLENLVYLDVRNNSLVGAIPLDFVSCKQIDTISLSNNQFTGGLPPGLGNCTSLREFGAFSCALSGP 299          

HSP 4 Score: 113.62 bits (283), Expect = 1.598e-24
Identity = 73/249 (29.32%), Postives = 116/249 (46.59%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG +P+++GN+  L+ L L +N                N + L  + +  N L G +P    +    + T+ + N   +G +P  +G               +GPIP+ FG+L KL  LYLA N   G  P EL     +  L L  N+L G IP  L  L+ L+ L+L +N  +  +P + W ++ +       N L G L  D+  LK L+ + L EN+ +G +P  +G    L+++DL  N   G
Sbjct:  200 FSGPVPSSLGNITTLQELYLNDNNLVGTLPVTLN-----NLENLVYLDVRNNSLVGAIPLDFVSCKQ-IDTISLSNNQFTGGLPPGLGNCTSLREFGAFSCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGELGMLSQLQYLHLYTNNLSGEVPLSIWKIQSLQSLQLYQNNLSGELPVDMTELKQLVSLALYENHFTGVIPQDLGANSSLEVLDLTRNMFTG 442          

HSP 5 Score: 113.62 bits (283), Expect = 1.598e-24
Identity = 75/247 (30.36%), Postives = 114/247 (46.15%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G +P T+ NL NL +L + NN                +CK++  I L+ N   G LP  +GN + SL+     +C++SG IP   G               +G IP   G+ + +  L L  N+L G  P EL  L +L  L L+ N LSG +P  +  + SL+SL L  N  +  +P     LK ++      N   G +  D+G    L  ++L+ N  +G +P  +   K L+ + L YN LEG
Sbjct:  226 GTLPVTLNNLENLVYLDVRNN-----SLVGAIPLDFVSCKQIDTISLSNNQFTGGLPPGLGNCT-SLREFGAFSCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGELGMLSQLQYLHLYTNNLSGEVPLSIWKIQSLQSLQLYQNNLSGELPVDMTELKQLVSLALYENHFTGVIPQDLGANSSLEVLDLTRNMFTGHIPPNLCSQKKLKRLLLGYNYLEG 466          

HSP 6 Score: 102.834 bits (255), Expect = 2.821e-21
Identity = 82/273 (30.04%), Postives = 123/273 (45.05%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFW-----------------------SLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            F+G IP  + + + L+ L LG NY                C  L  + L  N L G LP  +   ++    L   N   +G IP S+G               +G IP   G L KL+ L L+ N L G  P EL +  +L +L    N L+GSIPS L +LT L  L LG N F+  IP++ +                       +L+ +   + SSN L G L  D+G LK+L  +++S NNLSG +   +  ++ L  +++++N   GP
Sbjct:  440 FTGHIPPNLCSQKKLKRLLLGYNYLEGSVPSDL-----GGCSTLERLILEENNLRGGLPDFVEKQNLLFFDLSGNN--FTGPIPPSLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGILPSELSNCHKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLNLQLGGNLLAGDIPPVGALQALRSLNLSSNKLNGQLPIDLGKLKMLEELDVSHNNLSGTL-RVLSTIQSLTFINISHNLFSGP 704          

HSP 7 Score: 80.8777 bits (198), Expect = 1.148e-14
Identity = 48/138 (34.78%), Postives = 72/138 (52.17%), Query Frame = 2
Query:  350 RLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            R Q +  L L+   + G F  E+ HL  L K+VL GN   GSIPS L N + L  + L SN FT  IP T  +L+++       N L+GP    + ++  L  +  + N L+G +P+ IG + +L  + L  N+  GP
Sbjct:   66 RRQFVDTLNLSSYGISGEFGPEISHLKHLKKVVLSGNGFFGSIPSQLGNCSLLEHIDLSSNSFTGNIPDTLGALQNLRNLSLFFNSLIGPFPESLLSIPHLETVYFTGNGLNGSIPSNIGNMSELTTLWLDDNQFSGP 203          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: GSO2_ARATH (LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 2.017e-27
Identity = 85/253 (33.60%), Postives = 121/253 (47.83%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDI-GNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++  SG IP+ +G+L NL+ L LG+N                N   L+ + L    L G++PS  G L + L+TL + +  + G IP  IG                G +P    RL+ LQ L L  N   G  P +L  L  +  L L GN+L G IP  L+ L +L++L L SN  T VI   FW +  + F   + N L G L   I  N   L  + LSE  LSG++PA I   + L+++DL+ N L G
Sbjct:  129 SNLLSGDIPSQLGSLVNLKSLKLGDN-----ELNGTIPETFGNLVNLQMLALASCRLTGLIPSRFGRL-VQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGDNSFSGEIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTG 375          

HSP 2 Score: 119.783 bits (299), Expect = 2.230e-26
Identity = 80/270 (29.63%), Postives = 123/270 (45.56%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTG-------------------NPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++FSG IP+ +G+L ++++L L  N                    L    LTG                   N L+G LP +I + + SLK L++    +SG IP  I                TG IP +  +L +L  LYL  N L G+    + +L  L +  L+ N L G +P  +  L  L  +YL  NRF+  +P    +   +   D+  N L G + S IG LK L  ++L EN L G++PA++G    + ++DLA N+L G
Sbjct:  250 NSFSGEIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSG 519          

HSP 3 Score: 117.472 bits (293), Expect = 1.107e-25
Identity = 85/248 (34.27%), Postives = 115/248 (46.37%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP++ G L  LE   + NN                N K L  I  + N  NG +    G  S S  +  +      G+IP  +G               TG IP TFG++ +L  L ++ N L G  P EL    +L  + L  N LSG IP+ L  L  L  L L SN+F   +P+  +SL +IL      N L G +  +IGNL+ L  +NL EN LSG +P+TIG L  L  + L+ N L G
Sbjct:  518 SGSIPSSFGFLTALELFMIYNN-----SLQGNLPDSLINLKNLTRINFSSNKFNGSISPLCG--SSSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIGKLSKLFELRLSRNALTG 758          

HSP 4 Score: 115.161 bits (287), Expect = 5.493e-25
Identity = 89/279 (31.90%), Postives = 126/279 (45.16%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSI-PSC----------------------LSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            G +P  IG L  LE + L  N                NC +L++I   GN L+G +PSSIG L   L  L++    + GNIP S+G               +G IP++FG L  L+   +  N L G+ PD L +L  L ++    NK +GSI P C                      L   T+L  L LG N+FT  IP TF  + ++   D S N L G +  ++G  K L  I+L+ N LSG +P  +G L  L  + L+ N+  G     I +L
Sbjct:  423 GKVPKEIGFLGKLEIMYLYEN-----RFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLK-DLTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDSLINLKNLTRINFSSNKFNGSISPLCGSSSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSLPTEIFSL 695          

HSP 5 Score: 114.005 bits (284), Expect = 1.224e-24
Identity = 82/252 (32.54%), Postives = 117/252 (46.43%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILF-FDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + F G IP  +G   NL+ L LG N                   +L  + ++ N L+GI+P  +G L   L  + + N  +SG IP  +G                G +PT    L  +  L+L  N L GS P E+ +L  L+ L L  N+LSG +PS +  L+ L  L L  N  T  IP     L+D+    D S N   G + S I  L  L  ++LS N L G++P  IG +K L  ++L+YN LEG
Sbjct:  586 NGFEGDIPLELGKSTNLDRLRLGKNQFTGRIPRTF-----GKISELSLLDISRNSLSGIIPVELG-LCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIGKLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEG 831          

HSP 6 Score: 113.62 bits (283), Expect = 1.598e-24
Identity = 82/251 (32.67%), Postives = 125/251 (49.80%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFG---NKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G I  +IG   NL  + L +N               +    L  + L  N L+G +PS +G+L ++LK+L +G+  ++G IP++ G               TG IP+ FGRL +LQ L L  N+L G  P E   +G    L LF    N+L+GS+P+ L+ L +L++L LG N F+  IPS    L  I + +   N L G +   +  L  L  ++LS NNL+G +      +  L+ + LA NRL G
Sbjct:   84 TGSISPSIGRFNNLIHIDLSSNRLVGPIPTTLSNLSSS----LESLHLFSNLLSGDIPSQLGSL-VNLKSLKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPIPAE---IGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGDNSFSGEIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSG 326          

HSP 7 Score: 107.842 bits (268), Expect = 8.770e-23
Identity = 77/230 (33.48%), Postives = 107/230 (46.52%), Query Frame = 2
Query:   20 GFIPNTIGNLRN-LEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            G IP T+ NL + LE L L +N                +   L+ + L  N LNG +P + GNL ++L+ L + +C ++G IP   G                GPIP   G    L     AFN+L GS P EL  L  L  L L  N  SG IPS L +L S++ L L  N+   +IP     L ++   D SSN L G +  +   +  L  + L++N LSG +P TI
Sbjct:  109 GPIPTTLSNLSSSLESLHLFSNLLSGDIPSQL-----GSLVNLKSLKLGDNELNGTIPETFGNL-VNLQMLALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGDNSFSGEIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSGSLPKTI 332          

HSP 8 Score: 107.842 bits (268), Expect = 8.770e-23
Identity = 64/211 (30.33%), Postives = 104/211 (49.29%), Query Frame = 2
Query:  128 ANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +NC+ L+ + L+ N L G +P S+  L + L  LY+ N S+ G +  SI                 G +P   G L KL+ +YL  N+  G  P E+ +  RL ++  +GN+LSG IPS +  L  L  L+L  N     IP++  +   +   D + N L G + S  G L  L    +  N+L G++P ++  LK+L  ++ + N+  G
Sbjct:  358 SNCQSLKLLDLSNNTLTGQIPDSLFQL-VELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDSLINLKNLTRINFSSNKFNG 567          

HSP 9 Score: 106.686 bits (265), Expect = 1.954e-22
Identity = 78/228 (34.21%), Postives = 105/228 (46.05%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRS-LYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDM 694
            F+G IP T G +  L  L +  N                 CKKL  I L  N L+G++P+ +G L + L  L + +    G++P  I                 G IP   G LQ L  L L  N+L G  P  +  L +L +L L  N L+G IP  +  L  L+S L L  N FT  IPST  +L  +   D S N LVG +   IG++K L  +NLS NNL G +
Sbjct:  612 FTGRIPRTFGKISELSLLDISRNSLSGIIPVELGL-----CKKLTHIDLNNNYLSGVIPTWLGKLPL-LGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIGKLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKL 833          

HSP 10 Score: 103.219 bits (256), Expect = 2.160e-21
Identity = 78/267 (29.21%), Postives = 120/267 (44.94%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNN-------------------YXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP  I N ++L+ L L NN                   Y              +N   L++  L  N L G +P  IG L   L+ +Y+     SG +P  IG               +G IP++ GRL+ L  L+L  N+LVG+ P  L +  ++  + L  N+LSGSIPS    LT+L    + +N     +P +  +LK++   +FSSN   G +S   G+    L  +++EN   GD+P  +G   +L  + L  N+  G
Sbjct:  350 SGEIPAEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLG-KLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDSLINLKNLTRINFSSNKFNGSISPLCGS-SSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTG 614          

HSP 11 Score: 98.9821 bits (245), Expect = 4.074e-20
Identity = 63/179 (35.20%), Postives = 87/179 (48.60%), Query Frame = 2
Query:  227 LYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRL-QKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            L +    ++G+I  SIG                GPIPTT   L   L+ L+L  N L G  P +L  L  L  L L  N+L+G+IP    NL +L+ L L S R T +IPS F  L  +       N L GP+ ++IGN   L     + N L+G +PA +  LK+LQ ++L  N   G
Sbjct:   76 LNLSGLGLTGSISPSIGRFNNLIHIDLSSNRLVGPIPTTLSNLSSSLESLHLFSNLLSGDIPSQLGSLVNLKSLKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGDNSFSG 254          

HSP 12 Score: 69.707 bits (169), Expect = 2.647e-11
Identity = 50/137 (36.50%), Postives = 70/137 (51.09%), Query Frame = 2
Query:  356 QKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTS-LRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            +++ GL L+   L GS    +     L  + L  N+L G IP+ LSNL+S L SL+L SN  +  IPS   SL ++       N L G +    GNL  L  + L+   L+G +P+  G L  LQ + L  N LEGP
Sbjct:   71 REIIGLNLSGLGLTGSISPSIGRFNNLIHIDLSSNRLVGPIPTTLSNLSSSLESLHLFSNLLSGDIPSQLGSLVNLKSLKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIPSRFGRLVQLQTLILQDNELEGP 207          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: ERL1_ARATH (LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.441e-27
Identity = 74/203 (36.45%), Postives = 108/203 (53.20%), Query Frame = 2
Query:  152 IGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + L+ N L G +P  +GNLS + K LY+    ++G IP  +G                G IP   G+L++L  L LA N+LVG  P  +     L++  + GN LSGSIP    NL SL  L L SN F   IP     + ++   D S N   G +   +G+L+ LL +NLS N+LSG +PA  G L+ +Q++D+++N L G
Sbjct:  291 LDLSDNELVGPIPPILGNLSFTGK-LYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLSGSIPLAFRNLGSLTYLNLSSNNFKGKIPVELGHIINLDKLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSG 492          

HSP 2 Score: 119.013 bits (297), Expect = 3.804e-26
Identity = 80/248 (32.26%), Postives = 121/248 (48.79%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP +IGN  + + L +  N               A       + L GN L G +P  IG L  +L  L + +  + G IP  +G               TGPIP+  G + +L  L L  NKLVG+ P EL  L +L +L L  N+L G IPS +S+  +L    +  N  +  IP  F +L  + + + SSN   G +  ++G++  L  ++LS NN SG +P T+G L+ L I++L+ N L G
Sbjct:  228 TGTIPESIGNCTSFQILDISYNQITGEIPYNIGFLQVAT------LSLQGNRLTGRIPEVIG-LMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLSGSIPLAFRNLGSLTYLNLSSNNFKGKIPVELGHIINLDKLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLSG 468          

HSP 3 Score: 105.531 bits (262), Expect = 4.353e-22
Identity = 77/247 (31.17%), Postives = 108/247 (43.72%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G IP  +GNL        G  Y               N  +L  + L  N L G +P  +G L   L  L + N  + G IP +I                +G IP  F  L  L  L L+ N   G  P EL H+  LDKL L GN  SGSIP  L +L  L  L L  N  +  +P+ F +L+ I   D S N L G + +++G L+ L  + L+ N L G +P  +     L  +++++N L G
Sbjct:  300 GPIPPILGNLSFT-----GKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQ-LFELNLANNRLVGPIPSNISSCAALNQFNVHGNLLSGSIPLAFRNLGSLTYLNLSSNNFKGKIPVELGHIINLDKLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSGVIPTELGQLQNLNSLILNNNKLHGKIPDQLTNCFTLVNLNVSFNNLSG 540          

HSP 4 Score: 92.8189 bits (229), Expect = 2.920e-18
Identity = 56/186 (30.11%), Postives = 91/186 (48.92%), Query Frame = 2
Query:  203 NLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            N+S S+ +L + + ++ G I  +IG                G IP   G    L  L L+ N L G  P  +  L +L+ L L  N+L+G +P+ L+ + +L+ L L  N  T  I    +  + + +     N L G LSSD+  L  L   ++  NNL+G +P +IG     QI+D++YN++ G
Sbjct:   68 NVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEISRLLYWNEVLQYLGLRGNMLTGTLSSDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFQILDISYNQITG 253          

HSP 5 Score: 92.0485 bits (227), Expect = 4.980e-18
Identity = 82/295 (27.80%), Postives = 120/295 (40.68%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLR-----------------------SLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLS------------------------SDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            G I   IG+LRNL+ + L  N                NC  L  + L+ N L G +P SI  L   L+TL + N  ++G +P ++                TG I       + LQ L L  N L G+   ++C L  L    + GN L+G+IP  + N TS +                       +L L  NR T  IP     ++ +   D S N LVGP+                         S++GN+  L  + L++N L G +P  +G L+ L  ++LA NRL GP
Sbjct:   85 GEISPAIGDLRNLQSIDLQGN-----KLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQ-LETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEISRLLYWNEVLQYLGLRGNMLTGTLSSDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFQILDISYNQITGEIPYNIGFLQVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLANNRLVGP 373          

HSP 6 Score: 83.5741 bits (205), Expect = 1.771e-15
Identity = 60/203 (29.56%), Postives = 96/203 (47.29%), Query Frame = 2
Query:  152 IGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + L+   L G +  +IG+L  +L+++ +    ++G IP  IG                G IP +  +L++L+ L L  N+L G  P  L  +  L +L L GN L+G I   L     L+ L L  N  T  + S    L  + +FD   N L G +   IGN      +++S N ++G++P  IG L+ +  + L  NRL G
Sbjct:   76 LNLSSLNLGGEISPAIGDLR-NLQSIDLQGNKLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEISRLLYWNEVLQYLGLRGNMLTGTLSSDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFQILDISYNQITGEIPYNIGFLQ-VATLSLQGNRLTG 276          

HSP 7 Score: 76.2554 bits (186), Expect = 2.828e-13
Identity = 55/201 (27.36%), Postives = 85/201 (42.29%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLS-----------------------MSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIP 553
            G IP  +G L  L  L L NN               ++C  L    + GN L+G +P +  NL                        ++L  L +   + SG+IP ++G               +G +P  FG L+ +Q + ++FN L G  P EL  L  L+ L+L  NKL G IP  L+N  +L +L +  N  + ++P
Sbjct:  348 GTIPPELGKLEQLFELNLANN-----RLVGPIPSNISSCAALNQFNVHGNLLSGSIPLAFRNLGSLTYLNLSSNNFKGKIPVELGHIINLDKLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSGVIPTELGQLQNLNSLILNNNKLHGKIPDQLTNCFTLVNLNVSFNNLSGIVP 543          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: RLK5_ARATH (Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 5.869e-27
Identity = 79/249 (31.73%), Postives = 119/249 (47.79%), Query Frame = 2
Query:   20 GFIPNTIG-NLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIG-NCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G IP ++  NL NL++L +  N                  +KL  + L GN L+G +P+S+GN++ +LK L +  N      IP  +G                GPIP +  RL  L  L L FN+L GS P  +  L  ++++ LF N  SG +P  + N+T+L+      N+ T  IP    +L ++   +   N L GPL   I   K L  + L  N L+G +P+ +G    LQ +DL+YNR  G
Sbjct:  128 GSIPKSLPFNLPNLKFLEISGN-----NLSDTIPSSFGEFRKLESLNLAGNFLSGTIPASLGNVT-TLKELKLAYNLFSPSQIPSQLGNLTELQVLWLAGCNLVGPIPPSLSRLTSLVNLDLTFNQLTGSIPSWITQLKTVEQIELFNNSFSGELPESMGNMTTLKRFDASMNKLTGKIPDNL-NLLNLESLNLFENMLEGPLPESITRSKTLSELKLFNNRLTGVLPSQLGANSPLQYVDLSYNRFSG 369          

HSP 2 Score: 100.523 bits (249), Expect = 1.400e-20
Identity = 75/251 (29.88%), Postives = 112/251 (44.62%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++FSG +P ++GN+  L+      N                N   L  + L  N L G LP SI   S +L  L + N  ++G +P  +G               +G IP       KL+ L L  N   G   + L     L ++ L  NKLSG IP     L  L  L L  N FT  IP T    K++     S N   G + ++IG+L  ++ I+ +EN+ SG++P ++  LK L  +DL+ N+L G
Sbjct:  270 NSFSGELPESMGNMTTLKRFDASMN------KLTGKIPDNLNLLNLESLNLFENMLEGPLPESITR-SKTLSELKLFNNRLTGVLPSQLGANSPLQYVDLSYNRFSGEIPANVCGEGKLEYLILIDNSFSGEISNNLGKCKSLTRVRLSNNKLSGQIPHGFWGLPRLSLLELSDNSFTGSIPKTIIGAKNLSNLRISKNRFSGSIPNEIGSLNGIIEISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSG 513          

HSP 3 Score: 94.3597 bits (233), Expect = 1.003e-18
Identity = 78/271 (28.78%), Postives = 118/271 (43.54%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIG--------NLSMS---------------LKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP+ + NL NLE L L  N                  K L ++ L  N L G+LPS +G        +LS +               L+ L + + S SG I  ++G               +G IP  F  L +L  L L+ N   GS P  +     L  L +  N+ SGSIP+ + +L  +  +    N F+  IP +   LK +   D S N L G +  ++   K L  +NL+ N+LSG++P  +G L  L  +DL+ N+  G
Sbjct:  297 TGKIPDNL-NLLNLESLNLFENMLEGPLPESI-----TRSKTLSELKLFNNRLTGVLPSQLGANSPLQYVDLSYNRFSGEIPANVCGEGKLEYLILIDNSFSGEISNNLGKCKSLTRVRLSNNKLSGQIPHGFWGLPRLSLLELSDNSFTGSIPKTIIGAKNLSNLRISKNRFSGSIPNEIGSLNGIIEISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSGEIPRELRGWKNLNELNLANNHLSGEIPKEVGILPVLNYLDLSSNQFSG 561          

HSP 4 Score: 88.9669 bits (219), Expect = 1.841e-18
Identity = 65/208 (31.25%), Postives = 102/208 (49.04%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIG-XXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGS-IPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            L  + L  N +NG L +   +   +L +L +    + G+IP+S+                 +  IP++FG  +KL+ L LA N L G+ P  L ++  L +L L  N  S S IPS L NLT L+ L+L        IP +   L  ++  D + N L G + S I  LK +  I L  N+ SG++P ++G +  L+  D + N+L G
Sbjct:   91 LHSLSLYNNSINGSLSADDFDTCHNLISLDLSENLLVGSIPKSLPFNLPNLKFLEISGNNLSDTIPSSFGEFRKLESLNLAGNFLSGTIPASLGNVTTLKELKLAYNLFSPSQIPSQLGNLTELQVLWLAGCNLVGPIPPSLSRLTSLVNLDLTFNQLTGSIPSWITQLKTVEQIELFNNSFSGELPESMGNMTTLKRFDASMNKLTG 298          

HSP 5 Score: 25.0238 bits (53), Expect = 1.841e-18
Identity = 17/40 (42.50%), Postives = 25/40 (62.50%), Query Frame = 1
Query:  796 ESLNLSNIKSPGLFQNPWGTLLPREVISLS*TRSEILVEN 915
            ++LNL N++S  LF+N     LP E I+ S T SE+ + N
Sbjct:  302 DNLNLLNLESLNLFENMLEGPLP-ESITRSKTLSELKLFN 340          

HSP 6 Score: 73.9442 bits (180), Expect = 1.403e-12
Identity = 69/230 (30.00%), Postives = 98/230 (42.61%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            ++FSG I N +G  ++L  + L NN                +  +L D   TG+     +P +I   + +L  L I     SG+IP  IG               +G IP +  +L++L  L L+ N+L G  P EL     L++L L  N LSG IP  +  L  L  L L SN+F+  IP    +LK                      L VL   NLS N+LSG +P
Sbjct:  389 NSFSGEISNNLGKCKSLTRVRLSNNKLSGQIPHGFWGLPRLSLLELSDNSFTGS-----IPKTIIG-AKNLSNLRISKNRFSGSIPNEIGSLNGIIEISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSGEIPRELRGWKNLNELNLANNHLSGEIPKEVGILPVLNYLDLSSNQFSGEIPLELQNLK----------------------LNVL---NLSYNHLSGKIP 587          

HSP 7 Score: 72.7886 bits (177), Expect = 3.127e-12
Identity = 44/121 (36.36%), Postives = 66/121 (54.55%), Query Frame = 2
Query:  392 LVGSFPDELCHLGRLDKLVLFGNKLSGSIPS-CLSNLTSLRSLYLGSNRFTSVIPSTF-WSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYN 748
            LVG FP  LCHL  L  L L+ N ++GS+ +       +L SL L  N     IP +  ++L ++ F + S N L   + S  G  + L  +NL+ N LSG +PA++G +  L+ + LAYN
Sbjct:   77 LVGPFPSILCHLPSLHSLSLYNNSINGSLSADDFDTCHNLISLDLSENLLVGSIPKSLPFNLPNLKFLEISGNNLSDTIPSSFGEFRKLESLNLAGNFLSGTIPASLGNVTTLKELKLAYN 197          

HSP 8 Score: 72.0182 bits (175), Expect = 5.333e-12
Identity = 51/151 (33.77%), Postives = 75/151 (49.67%), Query Frame = 2
Query:  326 GPIPTTFGRLQKLQGLYLAFNKLVGSFPDE---LCHLGRLDKLVLFGNKLSGSIPSCLS-NLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLS-GDMPATIGGLKDLQIMDLAYNRLEGP 763
            GP P+    L  L  L L  N + GS   +    CH   L  L L  N L GSIP  L  NL +L+ L +  N  +  IPS+F   + +   + + NFL G + + +GN+  L  + L+ N  S   +P+ +G L +LQ++ LA   L GP
Sbjct:   79 GPFPSILCHLPSLHSLSLYNNSINGSLSADDFDTCH--NLISLDLSENLLVGSIPKSLPFNLPNLKFLEISGNNLSDTIPSSFGEFRKLESLNLAGNFLSGTIPASLGNVTTLKELKLAYNLFSPSQIPSQLGNLTELQVLWLAGCNLVGP 227          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: GSO1_ARATH (LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 5.869e-27
Identity = 80/252 (31.75%), Postives = 115/252 (45.63%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            A+   G IP ++ +L NL+ L L  N                N  +L D+ L  N L+G LP SI + + +L+ L +    +SG IP  +                 G IP     L +L  LYL  N L G+    + +L  L  LVL+ N L G +P  +S L  L  L+L  NRF+  IP    +   +   D   N   G +   IG LK L  ++L +N L G +PA++G    L I+DLA N+L G
Sbjct:  272 ANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFW-----NMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSG 518          

HSP 2 Score: 115.931 bits (289), Expect = 3.221e-25
Identity = 79/261 (30.27%), Postives = 125/261 (47.89%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            A+  +G IP    N+  L  L L NN+              +N   L  + L+G  L+G +P  +     SLK L + N S++G+IP+++                 G +  +   L  LQ L L  N L G  P E+  L +L+ L L+ N+ SG IP  + N TSL+ + +  N F   IP +   LK++       N LVG L + +GN   L  ++L++N LSG +P++ G LK L+ + L  N L+G     +++L
Sbjct:  296 ANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSIC----SNNTNLEQLVLSGTQLSGEIPVELSKCQ-SLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISL 551          

HSP 3 Score: 114.005 bits (284), Expect = 1.224e-24
Identity = 77/253 (30.43%), Postives = 123/253 (48.62%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDI-GNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++  +G IP+ +G+L N+  L +G+N                N   L+ + L    L G +PS +G L + +++L + +  + G IP  +G                G IP   GRL+ L+ L LA N L G  P +L  + +L  L L  N+L G IP  L++L +L++L L +N  T  IP  FW++  +L    ++N L G L   I  N   L  + LS   LSG++P  +   + L+ +DL+ N L G
Sbjct:  128 SNQLTGEIPSQLGSLVNIRSLRIGDN-----ELVGDIPETLGNLVNLQMLALASCRLTGPIPSQLGRL-VRVQSLILQDNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAG 374          

HSP 4 Score: 112.079 bits (279), Expect = 4.650e-24
Identity = 72/211 (34.12%), Postives = 111/211 (52.61%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVL-LGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            N + L  + L  N L G +P ++G +   L  L + + +++G IP  +                +GPIP   G+L +L  L L+ N+ V S P EL +  +L  L L GN L+GSIP  + NL +L  L L  N+F+  +P     L  +     S N L G +  +IG L+ L   ++LS NN +GD+P+TIG L  L+ +DL++N+L G
Sbjct:  597 NSQNLDRLRLGKNQLTGKIPWTLGKIR-ELSLLDMSSNALTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTG 806          

HSP 5 Score: 110.923 bits (276), Expect = 1.036e-23
Identity = 76/248 (30.65%), Postives = 117/248 (47.18%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G I    G   NL  L L +N               +N   L  + L  N L G +PS +G+L +++++L IG+  + G+IP+++G               TGPIP+  GRL ++Q L L  N L G  P EL +   L       N L+G+IP+ L  L +L  L L +N  T  IPS    +  + +    +N L G +   + +L  L  ++LS NNL+G++P     +  L  + LA N L G
Sbjct:   84 TGSISPWFGRFDNLIHLDLSSN-----NLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQLGSL-VNIRSLRIGDNELVGDIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSG 325          

HSP 6 Score: 110.538 bits (275), Expect = 1.353e-23
Identity = 76/253 (30.04%), Postives = 120/253 (47.43%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            H +   G +  +I NL NL+WL L +N               +  +KL  + L  N  +G +P  IGN + SLK + +      G IP SIG                G +P + G   +L  L LA N+L GS P     L  L++L+L+ N L G++P  L +L +L  + L  NR    I     S    L FD ++N     +  ++GN + L  + L +N L+G +P T+G +++L ++D++ N L G
Sbjct:  392 HNNTLEGTLSPSISNLTNLQWLVLYHN-----NLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCT-SLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTIHPLCGS-SSYLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTG 637          

HSP 7 Score: 108.227 bits (269), Expect = 6.715e-23
Identity = 78/248 (31.45%), Postives = 113/248 (45.56%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP++ G L+ LE L L NN                + + L  I L+ N LNG +    G  S S  +  + N      IP  +G               TG IP T G++++L  L ++ N L G+ P +L    +L  + L  N LSG IP  L  L+ L  L L SN+F   +P+  ++   +L      N L G +  +IGNL  L  +NL +N  SG +P  +G L  L  + L+ N L G
Sbjct:  517 SGSIPSSFGFLKGLEQLMLYNN-----SLQGNLPDSLISLRNLTRINLSHNRLNGTIHPLCG--SSSYLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTG 757          

HSP 8 Score: 106.301 bits (264), Expect = 2.552e-22
Identity = 71/229 (31.00%), Postives = 110/229 (48.03%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            G IP  + NL +LE L L +N                +   +R + +  N L G +P ++GNL ++L+ L + +C ++G IP  +G                GPIP   G    L     A N L G+ P EL  L  L+ L L  N L+G IPS L  ++ L+ L L +N+   +IP +   L ++   D S+N L G +  +  N+  LL + L+ N+LSG +P +I
Sbjct:  109 GPIPTALSNLTSLESLFLFSNQLTGEIPSQL-----GSLVNIRSLRIGDNELVGDIPETLGNL-VNLQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSI 331          

HSP 9 Score: 104.76 bits (260), Expect = 7.425e-22
Identity = 70/249 (28.11%), Postives = 115/249 (46.18%), Query Frame = 2
Query:   17 SGFIPNTI-GNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG +P +I  N  NLE L L                  + C+ L+ + L+ N L G +P ++  L + L  LY+ N ++ G +  SI                 G +P     L+KL+ L+L  N+  G  P E+ +   L  + +FGN   G IP  +  L  L  L+L  N     +P++  +   +   D + N L G + S  G LK L  + L  N+L G++P ++  L++L  ++L++NRL G
Sbjct:  324 SGSLPKSICSNNTNLEQLVLSGTQLSGEIPVEL-----SKCQSLKQLDLSNNSLAGSIPEALFEL-VELTDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNG 566          

HSP 10 Score: 101.293 bits (251), Expect = 8.209e-21
Identity = 60/178 (33.71%), Postives = 88/178 (49.44%), Query Frame = 2
Query:  227 LYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            L +    ++G+I    G                GPIPT    L  L+ L+L  N+L G  P +L  L  +  L +  N+L G IP  L NL +L+ L L S R T  IPS    L  +       N+L GP+ +++GN   L     +EN L+G +PA +G L++L+I++LA N L G
Sbjct:   76 LNLTGLGLTGSISPWFGRFDNLIHLDLSSNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQLGSLVNIRSLRIGDNELVGDIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTG 253          

HSP 11 Score: 93.9745 bits (232), Expect = 1.311e-18
Identity = 73/227 (32.16%), Postives = 102/227 (44.93%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRS-LYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDM 694
            +G IP T+G +R L  L + +N                 CKKL  I L  N L+G +P  +G LS  L  L + +     ++P  +                 G IP   G L  L  L L  N+  GS P  +  L +L +L L  N L+G IP  +  L  L+S L L  N FT  IPST  +L  +   D S N L G +   +G++K L  +N+S NNL G +
Sbjct:  612 TGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVL-----CKKLTHIDLNNNFLSGPIPPWLGKLSQ-LGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTGEVPGSVGDMKSLGYLNVSFNNLGGKL 832          

HSP 12 Score: 79.337 bits (194), Expect = 3.340e-14
Identity = 50/115 (43.48%), Postives = 65/115 (56.52%), Query Frame = 2
Query:  428 GRLDKLV---LFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            GR D L+   L  N L G IP+ LSNLTSL SL+L SN+ T  IPS   SL +I       N LVG +   +GNL  L  + L+   L+G +P+ +G L  +Q + L  N LEGP
Sbjct:   92 GRFDNLIHLDLSSNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQLGSLVNIRSLRIGDNELVGDIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGP 206          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PEPR1_ARATH (Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.708e-26
Identity = 88/273 (32.23%), Postives = 127/273 (46.52%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKL----------VLFG--------------NKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG IP+T+GN   L  L L  N                + K+L  + L  N L G LP S+  +   L+ LY+   +++G IPQSIG               +G IP + G    LQ LYL  NKLVGS P+ L  LG L  L          V FG              N+  G +P  L N +SL +L + S   +  IPS+   LK++   + S N L G + +++GN   L  + L++N L G +P+ +G L+ L+ ++L  NR  G
Sbjct:  111 FSGTIPSTLGNCTKLATLDLSEN-----GFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIP-KLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFENRFSG 377          

HSP 2 Score: 107.457 bits (267), Expect = 1.145e-22
Identity = 71/232 (30.60%), Postives = 112/232 (48.28%), Query Frame = 2
Query:  137 KKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSEN------------------------NLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            K L+ + L+ N  +G +PS++GN +  L TL +     S  IP ++                TG +P +  R+ KLQ LYL +N L G  P  +     L +L ++ N+ SG+IP  + N +SL+ LYL  N+    +P +   L ++      +N L GP+     N K LL ++LS N                        NLSG +P+++G LK+L I++L+ NRL G
Sbjct:   99 KSLQILDLSTNNFSGTIPSTLGNCT-KLATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSG 329          

HSP 3 Score: 101.293 bits (251), Expect = 8.209e-21
Identity = 81/274 (29.56%), Postives = 125/274 (45.62%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTS------------------------VIPSTFWSLKDILF-FDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            +G IP  + + R L  L LG+N                +CK +R   L  N L+G+LP    + S+S   L   + +  G IP S+G               TG IP   G LQ L  + L+ N L GS P +L +   L++  +  N L+GS+PS  SN   L +L L  NRF+                          IPS+   ++D+++  D S N L G + + +G+L  L  +N+S NNL+G + + + GL  L  +D++ N+  GP
Sbjct:  448 TGEIPPNLCHGRKLRILNLGSNLLHGTIPASI-----GHCKTIRRFILRENNLSGLLPEFSQDHSLSF--LDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGLIEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSL-SVLKGLTSLLHVDVSNNQFTGP 713          

HSP 4 Score: 100.908 bits (250), Expect = 1.072e-20
Identity = 80/253 (31.62%), Postives = 113/253 (44.66%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            H +   G +P ++  L NL  L +GNN                NCK L  + L+ N   G +P ++GN S SL  L I    +SGN+                    +G IP++ G L+ L  L L+ N+L GS P EL +   L+ L L  N+L G IPS L  L  L SL L  NRF+  IP   W  + +       N L G L  ++  +K L    L  N+  G +P  +G    L+ +D   N+L G
Sbjct:  227 HRNKLVGSLPESLNLLGNLTTLFVGNN-----SLQGPVRFGSPNCKNLLTLDLSYNEFEGGVPPALGNCS-SLDALVI----VSGNL--------------------SGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKSQSLTQLLVYQNNLTGELPVEMTEMKKLKIATLFNNSFYGAIPPGLGVNSSLEEVDFIGNKLTG 449          

HSP 5 Score: 84.3445 bits (207), Expect = 1.038e-15
Identity = 55/185 (29.73%), Postives = 83/185 (44.86%), Query Frame = 2
Query:  209 SMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            S ++ +L      +SG +   IG               +G IP+T G   KL  L L+ N      PD L  L RL+ L L+ N L+G +P  L  +  L+ LYL  N  T  IP +    K+++     +N   G +   IGN   L  + L  N L G +P ++  L +L  + +  N L+GP
Sbjct:   74 SKNVASLNFTRSRVSGQLGPEIGELKSLQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIPDTLDSLKRLEVLYLYINFLTGELPESLFRIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGP 258          

HSP 6 Score: 77.411 bits (189), Expect = 1.269e-13
Identity = 59/181 (32.60%), Postives = 85/181 (46.96%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKL-QGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIP 553
            F+G IP  +GNL+NL ++ L  N               +NC  L    +  N LNG +PS+  N    L TL +     SG IPQ +                 G IP++ G ++ L   L L+ N L G  P +L  L +L +L +  N L+GS+ S L  LTSL  + + +N+FT  IP
Sbjct:  542 FTGQIPPQLGNLQNLGYMNLSRN-----LLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSNWK-GLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGLIEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSL-SVLKGLTSLLHVDVSNNQFTGPIP 715          

HSP 7 Score: 75.8702 bits (185), Expect = 3.693e-13
Identity = 58/215 (26.98%), Postives = 97/215 (45.12%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLV----LFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDI 634
            +++ F G IP ++G+ +NL  + L  N                N + L  + L+ N L G LP+ + N  +SL+   +G  S++G++P +                 +G IP     L+KL  L +A N   G  P     +G ++ L+    L GN L+G IP+ L +L  L  L + +N  T  + S    L  +L  D S+N   GP+  ++
Sbjct:  514 NSNNFEGPIPGSLGSCKNLSSINLSRN-----RFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSN-CVSLERFDVGFNSLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSS---IGLIEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSL-SVLKGLTSLLHVDVSNNQFTGPIPDNL 718          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: ERL2_ARATH (LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.708e-26
Identity = 83/266 (31.20%), Postives = 124/266 (46.62%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANC------------------KKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP +IGN  + E L +  N               A                    + L  + L+ N L G +P  +GNLS + K LY+    ++G IP  +G                G IP   G+L++L  L LA N LVG  P  +     L++  + GN LSG++P    NL SL  L L SN F   IP+    + ++   D S N   G +   +G+L+ LL +NLS N+L+G +PA  G L+ +QI+D+++N L G
Sbjct:  230 TGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGK-LYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAG 494          

HSP 2 Score: 105.916 bits (263), Expect = 3.333e-22
Identity = 74/248 (29.84%), Postives = 109/248 (43.95%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP  +GNL        G  Y               N  +L  + L  N L G +P  +G L   L  L + N ++ G IP +I                +G +P  F  L  L  L L+ N   G  P EL H+  LD L L GN  SGSIP  L +L  L  L L  N     +P+ F +L+ I   D S NFL G + +++G L+ +  + L+ N + G +P  +     L  +++++N L G
Sbjct:  301 TGPIPPILGNLSFT-----GKLYLHGNKLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQ-LFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIPTELGQLQNINSLILNNNKIHGKIPDQLTNCFSLANLNISFNNLSG 542          

HSP 3 Score: 91.2781 bits (225), Expect = 8.495e-18
Identity = 53/186 (28.49%), Postives = 93/186 (50.00%), Query Frame = 2
Query:  203 NLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            N+S+++ +L + N ++ G I  ++G                G IP   G    L  +  + N L G  P  +  L +L+ L L  N+L+G IP+ L+ + +L++L L  N+ T  IP   +  + + +     N L G LS D+  L  L   ++  NNL+G +P +IG     +I+D++YN++ G
Sbjct:   70 NVSLNVVSLNLSNLNLGGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWNEVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDVSYNQITG 255          

HSP 4 Score: 80.8777 bits (198), Expect = 1.148e-14
Identity = 62/227 (27.31%), Postives = 98/227 (43.17%), Query Frame = 2
Query:  152 IGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGN-----------------------LKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            + L+   L G + S++G+L M+L+++ +    + G IP  IG                G IP +  +L++L+ L L  N+L G  P  L  +  L  L L  N+L+G IP  L     L+ L L  N  T  +      L  + +FD   N L G +   IGN                          +  ++L  N L+G +P  IG ++ L ++DL+ N L GP
Sbjct:   78 LNLSNLNLGGEISSALGDL-MNLQSIDLQGNKLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWNEVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGP 303          

HSP 5 Score: 80.1073 bits (196), Expect = 1.958e-14
Identity = 50/178 (28.09%), Postives = 83/178 (46.63%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIP 553
            G IP+ I +   L    +  N+               N   L  + L+ N   G +P+ +G++ ++L TL +   + SG+IP ++G                G +P  FG L+ +Q + ++FN L G  P EL  L  ++ L+L  NK+ G IP  L+N  SL +L +  N  + +IP
Sbjct:  374 GLIPSNISSCAALNQFNVHGNFLSGAVPLEFR-----NLGSLTYLNLSSNSFKGKIPAELGHI-INLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIPTELGQLQNINSLILNNNKIHGKIPDQLTNCFSLANLNISFNNLSGIIP 545          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: ERECT_ARATH (LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.230e-26
Identity = 82/270 (30.37%), Postives = 125/270 (46.30%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANC------------------KKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            ++ +G IP TIGN    + L L  N               A                    + L  + L+GN L+G +P  +GNL+ + K LY+ +  ++G+IP  +G               TG IP   G+L  L  L +A N L G  PD L     L+ L + GNK SG+IP     L S+  L L SN     IP     + ++   D S+N + G + S +G+L+ LL +NLS N+++G +P   G L+ +  +DL+ N + GP
Sbjct:  222 NSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEK-LYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGP 490          

HSP 2 Score: 118.627 bits (296), Expect = 4.969e-26
Identity = 76/248 (30.65%), Postives = 120/248 (48.39%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP  +GNL   E L L +N                N  KL  + L  N L G +P  +G L+  L  L + N  + G IP  +                +G IP  F +L+ +  L L+ N + G  P EL  +G LD L L  NK++G IPS L +L  L  + L  N  T V+P  F +L+ I+  D S+N + GP+  ++  L+ ++ + L  NNL+G++  ++     L ++++++N L G
Sbjct:  296 SGSIPPILGNLTFTEKLYLHSN-----KLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLT-DLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNV-GSLANCLSLTVLNVSHNNLVG 536          

HSP 3 Score: 104.375 bits (259), Expect = 9.697e-22
Identity = 60/189 (31.75%), Postives = 98/189 (51.85%), Query Frame = 2
Query:  194 SIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            S  N++ ++  L + + ++ G I  +IG               +G IP   G    LQ L L+FN+L G  P  +  L +L++L+L  N+L G IPS LS + +L+ L L  N+ +  IP   +  + + +     N LVG +S D+  L  L   ++  N+L+G +P TIG     Q++DL+YN+L G
Sbjct:   62 SCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTG 250          

HSP 4 Score: 99.7525 bits (247), Expect = 2.388e-20
Identity = 77/267 (28.84%), Postives = 115/267 (43.07%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGN-------------------PLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            G IP+T+  + NL+ L L  N                    LR   L GN                    L G +P +IGN + + + L +    ++G IP  IG               +G IP+  G +Q L  L L+ N L GS P  L +L   +KL L  NKL+GSIP  L N++ L  L L  N  T  IP     L D+   + ++N L GP+   + +   L  +N+  N  SG +P     L+ +  ++L+ N ++GP
Sbjct:  154 GPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCT-AFQVLDLSYNQLTGEIPFDIGFLQVATLSLQGNQL-SGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGP 418          

HSP 5 Score: 87.4261 bits (215), Expect = 1.227e-16
Identity = 64/203 (31.53%), Postives = 95/203 (46.80%), Query Frame = 2
Query:  152 IGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + L+   L+G +  +IG+L   L     GN  +SG IP  IG               +G IP +  +L++L+ L L  N+L+G  P  L  +  L  L L  NKLSG IP  +     L+ L L  N     I      L  + +FD  +N L G +   IGN      ++LS N L+G++P  IG L+ +  + L  N+L G
Sbjct:   73 LNLSDLNLDGEISPAIGDLKSLLSIDLRGN-RLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQ-VATLSLQGNQLSG 273          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5148_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g61480 OS=Arabidopsis thaliana GN=At5g61480 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.107e-25
Identity = 76/250 (30.40%), Postives = 115/250 (46.00%), Query Frame = 2
Query:   11 AFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + SG +P  +GNL NLE L L  N               +N K L+ +  + N L+G +PS    L  +L  L + + ++SG +P+ IG               TG +P   G   KL+ + ++ N   G+ P  LCH  +L KL+LF N   G +P  L+   SL      +NR    IP  F SL+++ F D S+N     + +D     VL  +NLS N     +P  I    +LQI   +++ L G
Sbjct:  260 SLSGSLPQELGNLSNLETLFLFQN-----GFTGEIPESYSNLKSLKLLDFSSNQLSGSIPSGFSTLK-NLTWLSLISNNLSGEVPEGIGELPELTTLFLWNNNFTGVLPHKLGSNGKLETMDVSNNSFTGTIPSSLCHGNKLYKLILFSNMFEGELPKSLTRCESLWRFRSQNNRLNGTIPIGFGSLRNLTFVDLSNNRFTDQIPADFATAPVLQYLNLSTNFFHRKLPENIWKAPNLQIFSASFSNLIG 503          

HSP 2 Score: 112.464 bits (280), Expect = 3.561e-24
Identity = 77/251 (30.68%), Postives = 111/251 (44.22%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++  G  P +I +L  L  L +  N               +  K L+      N   G+LPS +  L   L+ L  G     G IP + G                G +P   G L +LQ + + +N   G+ P E   L  L    +    LSGS+P  L NL++L +L+L  N FT  IP ++ +LK +   DFSSN L G + S    LK L  ++L  NNLSG++P  IG L +L  + L  N   G
Sbjct:  115 NSLEGSFPTSIFDLTKLTTLDISRN-----SFDSSFPPGISKLKFLKVFNAFSNNFEGLLPSDVSRLRF-LEELNFGGSYFEGEIPAAYGGLQRLKFIHLAGNVLGGKLPPRLGLLTELQHMEIGYNHFNGNIPSEFALLSNLKYFDVSNCSLSGSLPQELGNLSNLETLFLFQNGFTGEIPESYSNLKSLKLLDFSSNQLSGSIPSGFSTLKNLTWLSLISNNLSGEVPEGIGELPELTTLFLWNNNFTG 359          

HSP 3 Score: 108.612 bits (270), Expect = 5.142e-23
Identity = 84/293 (28.67%), Postives = 124/293 (42.32%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLS-----------------------MSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDI--GN--LKVLLGINLSE--------------------NNLSGDMPATIGGLKDLQIMDLAYNR 751
            F G +P+ +  LR LE L  G +Y                 ++L+ I L GN L G LP  +G L+                        +LK   + NCS+SG++PQ +G               TG IP ++  L+ L+ L  + N+L GS P     L  L  L L  N LSG +P  +  L  L +L+L +N FT V+P    S   +   D S+N   G + S +  GN   K++L  N+ E                    N L+G +P   G L++L  +DL+ NR
Sbjct:  165 FEGLLPSDVSRLRFLEELNFGGSYFEGEIPAAY-----GGLQRLKFIHLAGNVLGGKLPPRLGLLTELQHMEIGYNHFNGNIPSEFALLSNLKYFDVSNCSLSGSLPQELGNLSNLETLFLFQNGFTGEIPESYSNLKSLKLLDFSSNQLSGSIPSGFSTLKNLTWLSLISNNLSGEVPEGIGELPELTTLFLWNNNFTGVLPHKLGSNGKLETMDVSNNSFTGTIPSSLCHGNKLYKLILFSNMFEGELPKSLTRCESLWRFRSQNNRLNGTIPIGFGSLRNLTFVDLSNNR 452          

HSP 4 Score: 101.293 bits (251), Expect = 8.209e-21
Identity = 66/203 (32.51%), Postives = 99/203 (48.77%), Query Frame = 2
Query:  152 IGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + L+GN L G  P+SI +L+  L TL I   S   + P  I                 G +P+   RL+ L+ L    +   G  P     L RL  + L GN L G +P  L  LT L+ + +G N F   IPS F  L ++ +FD S+  L G L  ++GNL  L  + L +N  +G++P +   LK L+++D + N+L G
Sbjct:  110 LNLSGNSLEGSFPTSIFDLT-KLTTLDISRNSFDSSFPPGISKLKFLKVFNAFSNNFEGLLPSDVSRLRFLEELNFGGSYFEGEIPAAYGGLQRLKFIHLAGNVLGGKLPPRLGLLTELQHMEIGYNHFNGNIPSEFALLSNLKYFDVSNCSLSGSLPQELGNLSNLETLFLFQNGFTGEIPESYSNLKSLKLLDFSSNQLSG 311          

HSP 5 Score: 74.3294 bits (181), Expect = 6.897e-13
Identity = 47/146 (32.19%), Postives = 71/146 (48.63%), Query Frame = 2
Query:  323 TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP     L  L  L L+ N L GSFP  +  L +L  L +  N    S P  +S L  L+     SN F  ++PS    L+ +   +F  ++  G + +  G L+ L  I+L+ N L G +P  +G L +LQ M++ YN   G
Sbjct:   94 SGRIPIQIRYLSSLLYLNLSGNSLEGSFPTSIFDLTKLTTLDISRNSFDSSFPPGISKLKFLKVFNAFSNNFEGLLPSDVSRLRFLEELNFGGSYFEGEIPAAYGGLQRLKFIHLAGNVLGGKLPPRLGLLTELQHMEIGYNHFNG 239          

HSP 6 Score: 20.7866 bits (42), Expect = 6.897e-13
Identity = 9/30 (30.00%), Postives = 14/30 (46.67%), Query Frame = 3
Query:  801 FEFVKYKISGSIPKSXGNSFTSRSNLSFMN 890
            F+     +SGS+P+  GN     +   F N
Sbjct:  254 FDVSNCSLSGSLPQELGNLSNLETLFLFQN 283          

HSP 7 Score: 74.3294 bits (181), Expect = 1.075e-12
Identity = 47/130 (36.15%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  371 LYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            L L+   L G  P ++ +L  L  L L GN L GS P+ + +LT L +L +  N F S  P     LK +  F+  SN   G L SD+  L+ L  +N   +   G++PA  GGL+ L+ + LA N L G
Sbjct:   86 LDLSHRNLSGRIPIQIRYLSSLLYLNLSGNSLEGSFPTSIFDLTKLTTLDISRNSFDSSFPPGISKLKFLKVFNAFSNNFEGLLPSDVSRLRFLEELNFGGSYFEGEIPAAYGGLQRLKFIHLAGNVLGG 215          

HSP 8 Score: 70.4774 bits (171), Expect = 1.552e-11
Identity = 58/231 (25.11%), Postives = 94/231 (40.69%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPA 700
            ++F+G IP+++ +   L  L L +N                 C+ L       N LNG +P   G+L  +L  + + N   +  IP                      +P    +   LQ    +F+ L+G  P+ +       ++ L GN L+G+IP  + +   L  L L  N    +IP    +L  I   D S N L G + SD G+ K +   N+S N L G +P+
Sbjct:  379 NSFTGTIPSSLCHGNKLYKLILFSNMFEGELPKSL-----TRCESLWRFRSQNNRLNGTIPIGFGSLR-NLTFVDLSNNRFTDQIPADFATAPVLQYLNLSTNFFHRKLPENIWKAPNLQIFSASFSNLIGEIPNYV-GCKSFYRIELQGNSLNGTIPWDIGHCEKLLCLNLSQNHLNGIIPWEISTLPSIADVDLSHNLLTGTIPSDFGSSKTITTFNVSYNQLIGPIPS 602          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y4361_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.107e-25
Identity = 84/273 (30.77%), Postives = 120/273 (43.96%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLG------------------------SNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG IP  IGNL+ LE L L NN                 C  L  +   GN L G +P  +G +  +LK L +G  S SG +P S+                 G  P     L  L  L L+ N+  G+ P  + +L  L  L L GN  SG IP+ + NL  L +L L                          N F+ V+P  F SL  + + + SSN   G +    G L++L+ ++LS+N++SG +P  IG    L++++L  NRL G
Sbjct:  344 FSGEIPPDIGNLKRLEELKLANN-----SLTGEIPVEIKQCGSLDVLDFEGNSLKGQIPEFLGYMK-ALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMG 610          

HSP 2 Score: 117.472 bits (293), Expect = 1.107e-25
Identity = 81/251 (32.27%), Postives = 117/251 (46.61%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++FSG++P+++ NL+ LE L LG N                    L ++ L+GN  +G +P SI NLS +L  L +     SG IP S+G                         L KL  L L+   + G  P EL  L  +  + L GN  SG +P   S+L SLR + L SN F+  IP TF  L+ ++    S N + G +  +IGN   L  + L  N L G +PA +  L  L+++DL  N L G
Sbjct:  414 NSFSGYVPSSMVNLQQLERLNLGENNLNGSFPVELMALT-----SLSELDLSGNRFSGAVPVSISNLS-NLSFLNLSGNGFSGEIPASVG------------------------NLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLPRLKVLDLGQNNLSG 634          

HSP 3 Score: 112.849 bits (281), Expect = 2.726e-24
Identity = 77/235 (32.77%), Postives = 114/235 (48.51%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKV-LLGINLSENNLSGDMPATIG 709
            + FSG IP ++GNL  L  L L                  +    ++ I L GN  +G++P    +L +SL+ + + + S SG IPQ+ G               +G IP   G    L+ L L  N+L+G  P +L  L RL  L L  N LSG IP  +S  +SL SL L  N  + VIP +F  L ++   D S N L G + + +  +   L+  N+S NNL G++PA++G
Sbjct:  486 NGFSGEIPASVGNLFKLTALDLSKQ-----NMSGEVPVELSGLPNVQVIALQGNNFSGVVPEGFSSL-VSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTKMDLSVNNLTGEIPASLALISSNLVYFNVSSNNLKGEIPASLG 714          

HSP 4 Score: 99.7525 bits (247), Expect = 2.388e-20
Identity = 72/250 (28.80%), Postives = 115/250 (46.00%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGL-KDLQIMDLAYNRLEG 760
            FSG +P +I NL NL +L L  N                N  KL  + L+   ++G +P  +  L  +++ + +   + SG +P+                  +G IP TFG L+ L  L L+ N + GS P E+ +   L+ L L  N+L G IP+ LS L  L+ L LG N  +  IP        +       N L G +      L  L  ++LS NNL+G++PA++  +  +L   +++ N L+G
Sbjct:  464 FSGAVPVSISNLSNLSFLNLSGN-----GFSGEIPASVGNLFKLTALDLSKQNMSGEVPVELSGLP-NVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTKMDLSVNNLTGEIPASLALISSNLVYFNVSSNNLKG 707          

HSP 5 Score: 92.4337 bits (228), Expect = 3.813e-18
Identity = 80/278 (28.78%), Postives = 114/278 (41.01%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIP--------------------------TTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ FSG IP+ + NL  L+ L L  N                N + L+ + L  N L G LPS+I N S SL  L      I G IP + G               +G +P                          TT      LQ L L  N++ G FP  L ++  L  L + GN  SG IP  + NL  L  L L +N  T  IP        +   DF  N L G +   +G +K L  ++L  N+ SG +P+++  L+ L+ ++L  N L G
Sbjct:  171 SNTFSGQIPSGLANLTQLQLLNLSYN-----QLTGEIPASLGNLQSLQYLWLDFNLLQGTLPSAISNCS-SLVHLSASENEIGGVIPAAYGALPKLEVLSLSNNNFSGTVPFSLFCNTSLTIVQLGFNAFSDIVRPETTANCRTGLQVLDLQENRISGRFPLWLTNILSLKNLDVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIPVEIKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLNG 442          

HSP 6 Score: 91.6633 bits (226), Expect = 6.504e-18
Identity = 64/207 (30.92%), Postives = 98/207 (47.34%), Query Frame = 2
Query:  140 KLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ +I L    L+G +   I  L M L+ L + + S +G IP S+                +G +P     L  L+   +A N+L G  P  L     L  L +  N  SG IPS L+NLT L+ L L  N+ T  IP++  +L+ + +     N L G L S I N   L+ ++ SEN + G +PA  G L  L+++ L+ N   G
Sbjct:   69 RVTEIRLPRLQLSGRISDRISGLRM-LRKLSLRSNSFNGTIPTSLAYCTRLLSVFLQYNSLSGKLPPAMRNLTSLEVFNVAGNRLSGEIPVGLP--SSLQFLDISSNTFSGQIPSGLANLTQLQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFNLLQGTLPSAISNCSSLVHLSASENEIGGVIPAAYGALPKLEVLSLSNNNFSG 272          

HSP 7 Score: 89.7373 bits (221), Expect = 2.472e-17
Identity = 91/322 (28.26%), Postives = 126/322 (39.13%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSM---------------------SLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPD------ELCHLG------------------RLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVI-PST-----------------------FW-----SLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG I + I  LR L  L L +N               A C +L  + L  N L+G LP ++ NL+                      SL+ L I + + SG IP  +                TG IP + G LQ LQ L+L FN L G+ P        L HL                   +L+ L L  N  SG++P  L   TSL  + LG N F+ ++ P T                        W     SLK++   D S N   G +  DIGNLK L  + L+ N+L+G++P  I     L ++D   N L+G
Sbjct:   81 SGRISDRISGLRMLRKLSLRSN-----SFNGTIPTSLAYCTRLLSVFLQYNSLSGKLPPAMRNLTSLEVFNVAGNRLSGEIPVGLPSSLQFLDISSNTFSGQIPSGLANLTQLQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFNLLQGTLPSAISNCSSLVHLSASENEIGGVIPAAYGALPKLEVLSLSNNNFSGTVPFSLFCNTSLTIVQLGFNAFSDIVRPETTANCRTGLQVLDLQENRISGRFPLWLTNILSLKNL---DVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIPVEIKQCGSLDVLDFEGNSLKG 394          
The following BLAST results are available for this feature:
BLAST of EY659338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
RPK1_IPONI1.545e-2730.80Receptor-like protein kinase OS=Ipomoea nil GN=INR... [more]
GSO2_ARATH2.017e-2733.60LRR receptor-like serine/threonine-protein kinase ... [more]
ERL1_ARATH3.441e-2736.45LRR receptor-like serine/threonine-protein kinase ... [more]
RLK5_ARATH5.869e-2731.73Receptor-like protein kinase 5 OS=Arabidopsis thal... [more]
GSO1_ARATH5.869e-2731.75LRR receptor-like serine/threonine-protein kinase ... [more]
PEPR1_ARATH1.708e-2632.23Leucine-rich repeat receptor-like protein kinase P... [more]
ERL2_ARATH1.708e-2631.20LRR receptor-like serine/threonine-protein kinase ... [more]
ERECT_ARATH2.230e-2630.37LRR receptor-like serine/threonine-protein kinase ... [more]
Y5148_ARATH1.107e-2530.40Probable leucine-rich repeat receptor-like protein... [more]
Y4361_ARATH1.107e-2530.77Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659338 ID=EY659338|Name=EY659338|organism=Citrus sinensis|type=EST|length=918bp
CCACGCGTCCGCATTTTCGGGATTTATTCCAAACACAATTGGTAATTTAA
GAAACCTTGAGTGGCTCGGCTTGGGTAATAACTACTTGACATCTTCAACC
TCAAAATTGAGCTTTCTTTCCTCTTTGGCAAATTGCAAGAAATTAAGAGA
CATAGGCTTAACAGGCAATCCACTCAACGGTATCCTTCCAAGTTCAATAG
GTAATCTTTCCATGTCTTTGAAAACACTTTACATCGGCAATTGCAGTATT
AGTGGCAACATTCCTCAATCAATTGGCAATTTAAGCAACTTATTGGCCTT
AGTATTAGAACTCAATAAATTGACTGGACCTATCCCAACTACATTCGGCC
GACTGCAGAAACTCCAAGGCTTATATCTTGCATTCAATAAGTTGGTAGGT
TCATTCCCAGATGAGCTTTGCCATCTAGGAAGGCTGGATAAATTGGTCTT
ATTTGGCAATAAGCTTTCAGGATCTATACCTTCATGCTTAAGTAATCTCA
CTTCTCTGAGATCTCTCTACTTAGGGTCCAATAGGTTTACTTCTGTCATT
CCCTCAACTTTCTGGAGCCTAAAAGACATCTTGTTCTTTGACTTTTCATC
AAATTTCTTGGTGGGTCCTCTTTCTTCAGACATAGGTAATTTGAAGGTGC
TTCTAGGAATAAATTTATCAGAAAATAACTTATCGGGTGATATGCCAGCC
ACAATTGGAGGACTGAAAGATCTTCAAATTATGGACCTAGCATATAATAG
ATTGGAAGGCCCANTNCTGNANNTCATTGTGACTTTGATAGTTTAGAAAG
TTTGAATTTGTCAAATATAAAATCTCCGGGTCTATTCCAAAATCCNTGGG
GAACTCTTTTACCTCGAGAAGTAATCTCTCTTTCATGAACTAGAAGTGAG
ATTCTAGTGGAGAATTTT
back to top