EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D2_PIG (Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa GN=UBE2D2 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D2_MOUSE (Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus GN=Ube2d2 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D2_HUMAN (Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens GN=UBE2D2 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D2_BOVIN (Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus GN=UBE2D2 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.876e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 7.876e-38
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBCD1_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=eff PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 2.956e-37
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 76.6406 bits (187), Expect = 2.956e-37
Identity = 33/45 (73.33%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL+DL +DPP  CSAGP  +D+FHWQATIMGP DSPY
Sbjct:    1 MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D1_MOUSE (Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.017e-37
Identity = 41/56 (73.21%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + ++FP DYPFKPPK+AF TK++HPNINSNGSICLDIL+ QWSPALT+SK++
Sbjct:   48 GVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVL 103          

HSP 2 Score: 75.8702 bits (185), Expect = 5.017e-37
Identity = 33/45 (73.33%), Postives = 36/45 (80.00%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DLQ+DPP  CSAGP  +D+FHWQATIMGP DS Y
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D1_HUMAN (Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.017e-37
Identity = 41/56 (73.21%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + ++FP DYPFKPPK+AF TK++HPNINSNGSICLDIL+ QWSPALT+SK++
Sbjct:   48 GVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVL 103          

HSP 2 Score: 75.8702 bits (185), Expect = 5.017e-37
Identity = 33/45 (73.33%), Postives = 36/45 (80.00%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DLQ+DPP  CSAGP  +D+FHWQATIMGP DS Y
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D1_BOVIN (Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus GN=UBE2D1 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.017e-37
Identity = 41/56 (73.21%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + ++FP DYPFKPPK+AF TK++HPNINSNGSICLDIL+ QWSPALT+SK++
Sbjct:   48 GVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVL 103          

HSP 2 Score: 75.8702 bits (185), Expect = 5.017e-37
Identity = 33/45 (73.33%), Postives = 36/45 (80.00%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DLQ+DPP  CSAGP  +D+FHWQATIMGP DS Y
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC5_YEAST (Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae GN=UBC5 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.017e-37
Identity = 41/56 (73.21%), Postives = 52/56 (92.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF ++I+FP DYPFKPPKV F TK++HPNINS+G+ICLDILK+QWSPALT+SK++
Sbjct:   49 GVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVL 104          

HSP 2 Score: 78.5666 bits (192), Expect = 5.017e-37
Identity = 33/45 (73.33%), Postives = 39/45 (86.67%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +SKRI KEL DL +DPP SCSAGP  +D++HWQA+IMGPSDSPYA
Sbjct:    3 SSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYA 47          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D3_BOVIN (Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.017e-37
Identity = 42/56 (75.00%), Postives = 50/56 (89.29%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSN SICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNDSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 78.5666 bits (192), Expect = 5.017e-37
Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  +DMFHWQATIMGP+DSPY
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY 45          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UB2D2_PIG7.876e-3876.79Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa G... [more]
UB2D2_MOUSE7.876e-3876.79Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus... [more]
UB2D2_HUMAN7.876e-3876.79Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens... [more]
UB2D2_BOVIN7.876e-3876.79Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus G... [more]
UBCD1_DROME2.956e-3776.79Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophi... [more]
UB2D1_MOUSE5.017e-3773.21Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus... [more]
UB2D1_HUMAN5.017e-3773.21Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens... [more]
UB2D1_BOVIN5.017e-3773.21Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus G... [more]
UBC5_YEAST5.017e-3773.21Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharo... [more]
UB2D3_BOVIN5.017e-3775.00Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top