EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: UCPA_ECO57 (Oxidoreductase ucpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 1.684e-18
Identity = 75/248 (30.24%), Postives = 126/248 (50.81%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK------DWLNNVASRTYPLRDFGTTDP-ALTSLVRYLVHDSSDMYPGTFSLL 724
            TGA  G+G       A+ G  ++      + ++ L DE+    G   R  AV  DV  + A++  +++ A E  GRID LVNNAGV   + S LD+++++ +  +  N+ G W V+K V   M  A ++G ++ +SS+        PG  AYA +KA +  +TK L++E     IRVN+ICPG  ++ + E + ++      + +    ++  PLR     DP  +  L  +L  D S    GT +++
Sbjct:   12 TGALQGIGEGIARTFARHGANLILLDISPE-IEKLADEL---CGRGHRCTAVVADVR-DPASVAAAIKRAKEKEGRIDILVNNAGVC-RLGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMI-ARKDGRIVMMSSVTGDMVAD-PGETAYALTKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPEDPESVLTEMAKAIPLRRL--ADPLEVGELAAFLASDESSYLTGTQNVI 249          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YLX6_SCHPO (Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe GN=SPAC922.06 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.873e-18
Identity = 71/240 (29.58%), Postives = 115/240 (47.92%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLP-GGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK-DWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TGA+ G+G+  C    + G R+               +I   S     A+A++ DVS     IE +++   +  G ID L+NNAG+  A  +P + L+ E W+H +   L G++L  +YV   M    + GS++NI S+     G +  G  AY+++KAGL  +TK L++  G   IRVN   PG   S   +   KK   + +   R YP+   GT +    +++ +L    +    GT
Sbjct:   11 TGAAGGIGKVLCKMFTELGDRVAGI------------DIVDPSKVQDAALALQADVS-KADQIETAIEKVIQTLGPIDVLINNAGL--ADDTPFEQLSHESWDHDVSLVLRGNYLTQRYVIPHMAKQGKGGSIVNIGSV----NGHIYLGSPAYSAAKAGLENLTKALAVRYGPLGIRVNVCAPGTIWSPAWDERFKKHPDVGDRMKRWYPVGRLGTPEDVARAVI-FLADSKNSFITGT 230          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: UCPA_ECOLI (Oxidoreductase ucpA OS=Escherichia coli (strain K12) GN=ucpA PE=1 SV=3)

HSP 1 Score: 92.8189 bits (229), Expect = 2.873e-18
Identity = 74/248 (29.84%), Postives = 126/248 (50.81%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK------DWLNNVASRTYPLRDFGTTDP-ALTSLVRYLVHDSSDMYPGTFSLL 724
            TGA  G+G       A+ G  ++      + ++ L DE+    G   R  AV  DV  + A++  +++ A E  GRID LVNNAGV   + S LD+++++ +  +  N+ G W V+K V   M  A ++G ++ +SS+        PG  AYA +KA +  +TK L++E     IRVN+ICPG  ++ + E + ++      + +    ++  P+R     DP  +  L  +L  D S    GT +++
Sbjct:   12 TGALQGIGEGIARTFARHGANLILLDISPE-IEKLADEL---CGRGHRCTAVVADVR-DPASVAAAIKRAKEKEGRIDILVNNAGVC-RLGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMI-ARKDGRIVMMSSVTGDMVAD-PGETAYALTKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPEDPESVLTEMAKAIPMRRL--ADPLEVGELAAFLASDESSYLTGTQNVI 249          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y432_LISMO (Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes GN=lmo0432 PE=3 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 3.753e-18
Identity = 71/243 (29.22%), Postives = 120/243 (49.38%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVH--KIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSL 721
            TGASSG+G+   L LA+ G ++V AARRV++L+ +   I   SG ++ A   + DV+      +  V++A E +G++DA+  NAG+     SPL  L E+EW  ++  N+ G  L      +    A + G +I  SS+A       PGG  Y ++K  +  + + L +E       IR  +I P    +E+ E +  K+    + S     + +G T   + S+V Y +    D+    F++
Sbjct:   11 TGASSGIGKATALLLAEKGAKLVLAARRVEKLEKIVQTIKANSGEAIFA---KTDVTKR-EDNKKLVELAIERYGKVDAIFLNAGI--MPNSPLSALKEDEWEQMIDINIKGV-LNGIAAVLPSFIAQKSGHIIATSSVAGLK--AYPGGAVYGATKWAVRDLMEVLRMESAQEGTNIRTVTIYPAAINTELLETITDKETEQGMTSL---YKQYGITPDRIASIVAYAIDQPEDVNVNEFTV 241          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG4_BRANA (3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.901e-18
Identity = 73/238 (30.67%), Postives = 122/238 (51.26%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL---MKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMY 703
            TGAS G+G+   L L KAGC++ V  AR     + +  +I +  G   +A+    DVS   A ++  ++ A + +G ID +VNNAG +  ++    + + +W+ +M  NLTG +L S+    ++    ++G +INI+S+     G + G   YA++KAG+   +K  + E     I VN +CPG   S++T  L   M+K  L      T PL  +G  +  +  LV +L    +  Y
Sbjct:   20 TGASRGIGKAIALSLGKAGCKVLVNYARSAKEAEEVSKQIEEYGG---QAITFGGDVSKE-ADVDAMMKTAVDKWGTIDVVVNNAGDTLLIR----MKKSQWDEVMDLNLTGVFLCSQ-AATKIMMKKRKGRIINIASVVGLI-GNI-GQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILG-----TIPLGRYGQPED-VAGLVEFLALSPAASY 240          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG3_BRANA (3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.901e-18
Identity = 73/238 (30.67%), Postives = 122/238 (51.26%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL---MKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMY 703
            TGAS G+G+   L L KAGC++ V  AR     + +  +I    G   +A+    DVS   A +E  ++ A +A+G ID +VNNAG++      + + + +W+ ++  NLTG +L ++    ++    ++G +INI+S+     G + G   YA++KAG+   +K  + E     I VN +CPG   S++T  L   M+K  L      T PL  +G  +  +  LV +L    +  Y
Sbjct:   78 TGASRGIGKAIALSLGKAGCKVLVNYARSAKEAEEVSKQIEAYGG---QAITFGGDVSKE-ADVEAMMKTAIDAWGTIDVVVNNAGITRDTLL-IRMKKSQWDEVIDLNLTGVFLCTQ-AATKIMMKKRKGRIINIASVVGLI-GNI-GQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILG-----TIPLGRYGQPED-VAGLVEFLALSPAASY 301          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG1_BRANA (3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.901e-18
Identity = 73/238 (30.67%), Postives = 122/238 (51.26%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL---MKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMY 703
            TGAS G+G+   L L KAGC++ V  AR     + +  +I    G   +A+    DVS   A +E  ++ A +A+G ID +VNNAG++      + + + +W+ ++  NLTG +L ++    ++    ++G +INI+S+     G + G   YA++KAG+   +K  + E     I VN +CPG   S++T  L   M+K  L      T PL  +G  +  +  LV +L    +  Y
Sbjct:   83 TGASRGIGKAIALSLGKAGCKVLVNYARSAKEAEEVSKQIEAYGG---QAITFGGDVSKE-ADVEAMMKTAIDAWGTIDVVVNNAGITRDTLL-IRMKKSQWDEVIDLNLTGVFLCTQ-AATKIMMKKRKGRIINIASVVGLI-GNI-GQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILG-----TIPLGRYGQPED-VAGLVEFLALSPAASY 306          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YUXG_BACSU (Uncharacterized oxidoreductase yuxG OS=Bacillus subtilis GN=yuxG PE=3 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 6.401e-18
Identity = 66/187 (35.29%), Postives = 99/187 (52.94%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWE----AFGRIDALVNNAGVSGAVKSPLDLTE-EEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICP 547
            TG + G+G   C   A  G  ++ A   ++  + +  EIN   G   RAMAV++DV+      E  VQ A+E    A+G ID +VNNAG+  A  SP D T  +EWN  M    TG +LV++    +M+  N+ GS++ + S  +   G+     AY+S KA    + +C++ E G   IRVNS+ P
Sbjct:  433 TGGAGGIGSAACRRFAAEGGHVIVADLNIEGAQKIAGEINDAYGKG-RAMAVKMDVTK-----EEDVQSAFERAALAYGGIDIVVNNAGL--ATSSPFDETSLKEWNLNMNVLGTGYFLVAREAFKQMKHQNRGGSMVFVGSKNSVYAGK--NASAYSSVKALETHLARCIAAEGGEFGIRVNSVLP 609          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YGCW_ECOLI (Uncharacterized oxidoreductase ygcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 6.401e-18
Identity = 76/249 (30.52%), Postives = 121/249 (48.59%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSLLILGLRYXV 748
            TG +SGLG+ F + LAKAG  I   +   D  ++   E+ ++ G  V  M V   ++A GA  +  +    E FG +D LVNNAG+   +   LD    +W+ ++  NLT ++ +S Y   ++    + G +INI S+ +   GQ     AY+++K  L   TK    ELG + I+VN I PG + ++IT         N       P   +G T   + + V +L   +S+   G   LL++   Y V
Sbjct:   24 TGGNSGLGQAFAMALAKAGANIFIPSFVKDNGET--KEMIEKQGVEVDFMQV--GITAEGAP-QKIIAACCERFGTVDILVNNAGIC-KLNKVLDFGRADWDPMIDVNLTAAFELS-YEAAKIMIPQKSGKIINICSLFSYLGGQW--SPAYSATKHALAGFTKAYCDELGQYNIQVNGIAPGYYATDITLATRSNPETNQRVLDHIPANRWGDTQDLMGAAV-FLASPASNYVNG--HLLVVDGGYLV 260          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CBR2_MOUSE (Carbonyl reductase [NADPH] 2 OS=Mus musculus GN=Cbr2 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.401e-18
Identity = 66/232 (28.45%), Postives = 114/232 (49.14%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSP-LDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSS 694
            TGA  G+GR+    L  +G ++VA  R    L SL  E        +  + V+L          ++ + A    G +D LVNNA +   +  P L++T+E ++     NL   + VS+ V   M +    GS++N+SS+ A      P  + Y+S+K  +  +TK +++ELG HKIRVNS+ P +  +++ + +             +PLR F   +  + S++ +L+ D S
Sbjct:   13 TGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKEC-----PGIEPVCVDL-------GDWDATEKALGGIGPVDLLVNNAAL--VIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVA--HVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSIL-FLLSDRS 227          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
UCPA_ECO571.684e-1830.24Oxidoreductase ucpA OS=Escherichia coli O157:H7 GN... [more]
YLX6_SCHPO2.873e-1829.58Uncharacterized oxidoreductase C922.06 OS=Schizosa... [more]
UCPA_ECOLI2.873e-1829.84Oxidoreductase ucpA OS=Escherichia coli (strain K1... [more]
Y432_LISMO3.753e-1829.22Uncharacterized oxidoreductase Lmo0432 OS=Listeria... [more]
FABG4_BRANA4.901e-1830.673-oxoacyl-[acyl-carrier-protein] reductase 4 (Frag... [more]
FABG3_BRANA4.901e-1830.673-oxoacyl-[acyl-carrier-protein] reductase 3, chlo... [more]
FABG1_BRANA4.901e-1830.673-oxoacyl-[acyl-carrier-protein] reductase 1, chlo... [more]
YUXG_BACSU6.401e-1835.29Uncharacterized oxidoreductase yuxG OS=Bacillus su... [more]
YGCW_ECOLI6.401e-1830.52Uncharacterized oxidoreductase ygcW OS=Escherichia... [more]
CBR2_MOUSE6.401e-1828.45Carbonyl reductase [NADPH] 2 OS=Mus musculus GN=Cb... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top