EY659218

Overview
NameEY659218
Unique NameEY659218
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2470 contig Csv1_Contig2470:274..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_SYNPW (60 kDa chaperonin 2 OS=Synechococcus sp. (strain WH7803) GN=groL2 PE=3 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.332e-81
Identity = 155/269 (57.62%), Postives = 201/269 (74.72%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+GAP+I+NDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++  G++ VAAGAN + + +GI+K S  LV+E+K  +  + DS  +A V  +SAGN+ EVG MIA+AM KVG++GV++LEEGKS    L V EGM+FD+GYISPYF TD+E+M    +   +LL DKKI   +DL+ VLE   R   P+LIIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALEKGIDILAESVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKAGLRNVAAGANAITLKKGIDKASDFLVAEIKDKANPISDSNAIAQVGTISAGNDEEVGRMIADAMDKVGKEGVISLEEGKSMTTELEVTEGMRFDKGYISPYFATDTERMEAVLDEPYILLTDKKIGLVQDLVPVLEQIARTGKPLLIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_ANASL (60 kDa chaperonin 1 OS=Anabaena sp. (strain L31) GN=groL1 PE=1 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.332e-81
Identity = 155/269 (57.62%), Postives = 204/269 (75.84%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE KYGAP+IVNDGVT+AKE+ELED +EN G  L+RQAA+KTND+AGDGTTT+ VLA  ++ EG++ VAAGAN +L+ RGI+K +  LV  +++ ++ VEDS+ +A V A+SAGN+ EV  MIAEA+ KVG++ V++LEEGKS    L V EGM+FD+GYISPYF TD E+M   ++   L + DK+I   +DL+ VLE   R   P++IIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALERGIDILAEAVAVTLGPKGRNVVLEKKYGAPQIVNDGVTIAKEIELEDHIENTGVALIRQAASKTNDVAGDGTTTATVLAHAIVKEGLRNVAAGANAILLKRGIDKATNFLVDRIREHARSVEDSKAIAQVGAISAGNDDEVRQMIAEALDKVGKEAVISLEEGKSVTTELEVTEGMRFDKGYISPYFATDPERMEAIFDEPFLAVDDKQIALVQDLVPVLEPVARAGRPLVIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_NEIMF (60 kDa chaperonin OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18) GN=groL PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.740e-81
Identity = 154/267 (57.68%), Postives = 204/267 (76.40%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            +K+ NGVN LA+ V VTLGPKGRNVV++  +G P I  DGVTVAKE+EL+D  EN+GA++V++ A+KTND+AGDGTTT+ VLAQ ++AEG+K V AG NP  + RGI+K   ALV ELK ++K  + S E+A V ++SA ++ +VG +IAEAM KVG++GV+T+E+GKS EN L VVEGMQFDRGY+SPYF+ D+EK     +N  +LL DKKI+N RDL+ VLE   + + P+LIIAED+E EAL TLVVN +RG L+  A+K  G
Sbjct:   14 QKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_NEIMA (60 kDa chaperonin OS=Neisseria meningitidis serogroup A GN=groL PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.740e-81
Identity = 154/267 (57.68%), Postives = 204/267 (76.40%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            +K+ NGVN LA+ V VTLGPKGRNVV++  +G P I  DGVTVAKE+EL+D  EN+GA++V++ A+KTND+AGDGTTT+ VLAQ ++AEG+K V AG NP  + RGI+K   ALV ELK ++K  + S E+A V ++SA ++ +VG +IAEAM KVG++GV+T+E+GKS EN L VVEGMQFDRGY+SPYF+ D+EK     +N  +LL DKKI+N RDL+ VLE   + + P+LIIAED+E EAL TLVVN +RG L+  A+K  G
Sbjct:   14 QKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_NEIG1 (60 kDa chaperonin OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=groL PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.740e-81
Identity = 154/267 (57.68%), Postives = 204/267 (76.40%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            +K+ NGVN LA+ V VTLGPKGRNVV++  +G P I  DGVTVAKE+EL+D  EN+GA++V++ A+KTND+AGDGTTT+ VLAQ ++AEG+K V AG NP  + RGI+K   ALV ELK ++K  + S E+A V ++SA ++ +VG +IAEAM KVG++GV+T+E+GKS EN L VVEGMQFDRGY+SPYF+ D+EK     +N  +LL DKKI+N RDL+ VLE   + + P+LIIAED+E EAL TLVVN +RG L+  A+K  G
Sbjct:   14 QKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GRAFK (60 kDa chaperonin OS=Gramella forsetii (strain KT0803) GN=groL PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.740e-81
Identity = 152/270 (56.30%), Postives = 210/270 (77.78%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS--ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A   ++ GV+ LA+ V VTLGPKGRNV++   +GAP +  DGVTVAKE+ELEDP+EN+GA++V++ A+KTNDLAGDGTTT+ VLAQ ++ EG+K VAAGANP+ + RGI+K  +AL ++L + +KEV DS  ++  VA++SA N+  +G++IA+A  KVG++GV+T+EE K  E  + VVEGMQFDRGY+SPYFVT+SEKM  + E+  +LL DKKI++ +DL+ VLE   +   P+LIIAED++ EAL TLVVNKLRG+L+ AA+K  G
Sbjct:   11 ARNGIKRGVDALANAVKVTLGPKGRNVIISKSFGAPTVTKDGVTVAKEIELEDPLENMGAQMVKEVASKTNDLAGDGTTTATVLAQAIVQEGLKNVAAGANPMDLKRGIDKAVEALTADLAKQTKEVGDSSEKIKQVASISANNDDMIGDLIAQAFGKVGKEGVITVEEAKGTETHVDVVEGMQFDRGYLSPYFVTNSEKMTADLEDPYILLFDKKISSMKDLLPVLEPVAQSGKPLLIIAEDVDGEALATLVVNKLRGSLKIAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_ANATD (60 kDa chaperonin OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=groL PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.740e-81
Identity = 152/269 (56.51%), Postives = 208/269 (77.32%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ GVNKLAD V VTLGPKGRNVVLE K+G+P+IVNDGVT+AKE+ELEDP EN+GA++VR+ A+KTND+AGDGTTT+ VLAQ +I EG+K +AAGANP+++ +GI+K    +V E+++MSK+V   E +  VA++SAG+  E+G ++A+AM KV   GV+T+EE K+ E  L +VEGMQFDRGYIS Y VTD+E+M    ++  +L+ DKKI+  +D++ +LE  ++    +LIIAED+E EAL TLVVNKLRG L+  A+K  G
Sbjct:   12 ARRALERGVNKLADTVKVTLGPKGRNVVLEKKFGSPQIVNDGVTIAKEIELEDPFENMGAQIVREVASKTNDIAGDGTTTATVLAQAMIREGLKNIAAGANPMILRKGIQKAVDVVVEEIRKMSKKVRGKEDITYVASISAGDE-EIGKLVADAMEKVTNDGVITVEESKTTETTLEIVEGMQFDRGYISAYMVTDTERMEAVLDDPYILITDKKISTIQDILPLLEQIVQQGRKLLIIAEDVEGEALATLVVNKLRGTLQCVAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_NEIFL (60 kDa chaperonin OS=Neisseria flavescens GN=groL PE=3 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.272e-81
Identity = 154/267 (57.68%), Postives = 204/267 (76.40%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            +K+ NGVN LA+ V VTLGPKGRNVVL+  +G P I  DGV+VAKE+EL+D  EN+GA++V++ A+KTND+AGDGTTT+ VLAQ ++AEG+K V AG NP  + RGI+K   ALV ELK ++K  + S E+A V ++SA ++ +VG +IAEAM KVG++GV+T+E+GKS EN L VVEGMQFDRGY+SPYF+ D+EK     +N  +LL DKKI+N RDL+ VLE   + + P+LIIAED+E EAL TLVVN +RG L+  A+K  G
Sbjct:   14 QKMVNGVNILANAVRVTLGPKGRNVVLDRAFGGPHITKDGVSVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVDELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_BACST (60 kDa chaperonin OS=Bacillus stearothermophilus GN=groL PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.272e-81
Identity = 157/269 (58.36%), Postives = 200/269 (74.35%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + +  GV+KLAD V VTLGPKGRNVVLE K+G+P I NDGVT+AKE+ELEDP EN+GAKLV + A+KTND+AGDGTTT+ VLAQ +I EG+K V AGANP+ I +GIEK     V ELK +SK ++  E +A VAA+SA +  EVG +IAEAM +VG  GV+TLEE K     L VVEGMQFDRGY+SPY +TD+EKM    EN  +L+ DKK+++ ++++ +LE  ++   P+LIIAED+E EAL TLVVNKLRG     A+K  G
Sbjct:   11 ARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVAVAVEELKAISKPIQGKESIAQVAAISAADE-EVGQLIAEAMERVGNDGVITLEESKGFATELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSSIQEILPILEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPG 278          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_RHILO (60 kDa chaperonin 2 OS=Rhizobium loti GN=groL2 PE=3 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.272e-81
Identity = 153/269 (56.88%), Postives = 206/269 (76.58%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEV-EDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A +K+  GVN LAD V VTLGPKGRNVV++  +GAP+I  DGVTVAKE+ELED  EN+GA++VR+ A+KT+DLAGDGTTT+ VLAQ ++ EG K VA+G NP+ + RGI+K  +A+V ELK  +++V  + E+A V  +SA  + E+G  +AEAM KVG +GV+T+EE K+AE  L VVEGMQFDRGY+SPYF+T+ +KM VE E   +L+ +KK++N + L+ VLE  ++ + P+LIIAED+E EAL TLVVNKLRG L+ AA+K  G
Sbjct:   12 AREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDKAVEAIVQELKTNARKVTRNDEIAQVGTISANGDAEIGRFLAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEEPYVLIHEKKLSNLQALLPVLEAVVQSSKPLLIIAEDVEGEALATLVVNKLRGGLKVAAVKAPG 280          
The following BLAST results are available for this feature:
BLAST of EY659218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH602_SYNPW1.332e-8157.6260 kDa chaperonin 2 OS=Synechococcus sp. (strain W... [more]
CH601_ANASL1.332e-8157.6260 kDa chaperonin 1 OS=Anabaena sp. (strain L31) G... [more]
CH60_NEIMF1.740e-8157.6860 kDa chaperonin OS=Neisseria meningitidis serogr... [more]
CH60_NEIMA1.740e-8157.6860 kDa chaperonin OS=Neisseria meningitidis serogr... [more]
CH60_NEIG11.740e-8157.6860 kDa chaperonin OS=Neisseria gonorrhoeae (strain... [more]
CH60_GRAFK1.740e-8156.3060 kDa chaperonin OS=Gramella forsetii (strain KT0... [more]
CH60_ANATD1.740e-8156.5160 kDa chaperonin OS=Anaerocellum thermophilum (st... [more]
CH60_NEIFL2.272e-8157.6860 kDa chaperonin OS=Neisseria flavescens GN=groL ... [more]
CH60_BACST2.272e-8158.3660 kDa chaperonin OS=Bacillus stearothermophilus G... [more]
CH602_RHILO2.272e-8156.8860 kDa chaperonin 2 OS=Rhizobium loti GN=groL2 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659218 ID=EY659218|Name=EY659218|organism=Citrus sinensis|type=EST|length=881bp
AGAACTTGCATTTCAACAAGNATGGATATGCCATGAAGAAACTTCAAAAT
GGTGTCAACAAGCTTGCAGATCTAGTTGGAGTTACCCTTGGTCCCAAGGG
CAGGAATGTTGTTCTAGAGAGCAAGTACGGTGCCCCAAAAATTGTGAATG
ATGGTGTAACTGTGGCCAAAGAAGTTGAGTTAGAGGACCCGGTTGAGAAC
ATTGGTGCTAAATTAGTGAGACAAGCAGCTGCCAAGACTAATGACTTGGC
TGGTGATGGAACAACAACATCTGTTGTTCTTGCGCAAGGGCTTATAGCTG
AAGGTGTTAAGGTCGTGGCAGCTGGTGCAAATCCTGTTCTTATCACAAGA
GGCATTGAGAAGACATCTAAGGCTCTTGTTTCTGAGCTCAAGCAGATGTC
AAAAGAGGTTGAAGATAGTGAACTTGCCGATGTAGCAGCTGTTAGTGCAG
GGAACAACTATGAAGTTGGGAATATGATTGCAGAAGCCATGAGTAAAGTG
GGACGTAAGGGTGTGGTGACCCTTGAAGAGGGAAAAAGTGCTGAGAATAT
GCTCTATGTTGTTGAGGGAATGCAATTTGATCGTGGTTATATTTCTCCCT
ACTTCGTCACTGATAGTGAGAAAATGGCAGTTGAATATGAGAACTGCAAG
TTGCTTCTTGTGGATAAAAAGATTACCAATGCAAGGGACCTTATCAACGT
TTTGGAAGATGCGATTAGAGGTGCATACCCAATTTTGATTATTGCAGAAG
ATATTGAGCAAGAAGCACTGGGCACTCTTGTCGTGAACAAGCTGAGAGGT
GCATTGGAGAATGCTGCTCTTAAGCTCCTGGGTTTGAGAGCGGCAGAGCA
GTACCTTGAGACATTGCTTTTTGACTGGAGG
back to top