EY659217

Overview
NameEY659217
Unique NameEY659217
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length898
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig185 contig Csv1_Contig185:207..1104. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH32_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 32 OS=Arabidopsis thaliana GN=XTH32 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 4.162e-46
Identity = 97/227 (42.73%), Postives = 136/227 (59.91%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTS---IGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREF-KRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIR 713
            +GSGF S   +  G+F A+IKL   YTAGV+ + Y+SN +     HDE+D EFLG   GK + +QTN+Y  GS     IGRE ++ LWFDP+ DFH Y+ILW+  +IIF +D IPIR + K++AS    FP +PM LY +IWD S WAT  GKY+ +YKY P+  ++++F   GC+      +S++C    +S      G++  Q   M       M Y+YC D  R
Sbjct:   71 SGSGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVYIRGSGDGKIIGREMKFRLWFDPTKDFHHYAILWSPREIIFLVDDIPIRRYPKKSAS---TFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFTAKYTNFKALGCT----AYSSARCYPLSASPYR-SGGLTRQQHQAMRWVQTHSMVYNYCKDYKR 289          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH8_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 8 OS=Arabidopsis thaliana GN=XTH8 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 6.011e-45
Identity = 95/239 (39.75%), Postives = 143/239 (59.83%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGD--FP-AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSF-DPIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFECVINP 749
            TG GF +  +Y  G+FS  +KL    +AGVV A+YM + +      DEIDFEFLGN  G+ + IQTN+Y NG+ +  RE R++LWFDP+ D+H YSILW + Q++F++D +PIR +K +  +  +  FP  KPM L+++IW+  DWAT GG  + ++K AP+V+ + DF + GC + DP     S        +      +S +Q++      R  + Y YC D  R+   P+EC I+P
Sbjct:   55 TGCGFQTKHMYRFGWFSMKLKLVGGDSAGVVTAYYMCSENGAGPERDEIDFEFLGNRTGQPYIIQTNVYKNGTGN--REMRHSLWFDPTKDYHTYSILWNNHQLVFFVDRVPIRVYKNSDKVPNNDFFPNQKPMYLFSSIWNADDWATRGGLEKTDWKKAPFVSSYKDFAVEGCRWKDPFPACVSTTTENWWDQYD-AWHLSKTQKMDYAWVQRNLVVYDYCKDSERFPTLPWECSISP 290          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH4_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 4 OS=Arabidopsis thaliana GN=XTH4 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.749e-44
Identity = 99/233 (42.49%), Postives = 134/233 (57.51%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFP-AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFD-PIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            TG+GF S   YL G FS  IKLPA  TAGVV AFY+S+ +     HDEIDFEFLGN  G+   +QTN++  G  +  RE+R  LWFDPS  +H YSILW   QI+F++D IPIR FK    +G  FP  +PM LY+++W+  DWAT GG  + N+  AP+V  +  F + GC      +  +++  +    K          +R+K      K   Y+YC D+ R+ V P EC
Sbjct:   65 TGTGFQSKGSYLFGHFSMHIKLPAGDTAGVVTAFYLSSTN---NEHDEIDFEFLGNRTGQPAILQTNVFTGGKGN--REQRIYLWFDPSKAYHTYSILWNMYQIVFFVDNIPIRTFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLEKTNWANAPFVASYKGFHIDGCQASVEAKYCATQGRMWWDQKEFRDLDAEQWRRLKWVRM--KWTIYNYCTDRTRFPVMPAEC 290          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH_BRAOB (Xyloglucan endotransglucosylase/hydrolase OS=Brassica oleracea var. botrytis GN=XET16A PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.134e-43
Identity = 97/235 (41.28%), Postives = 134/235 (57.02%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFP-AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESS---KVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            TG+GF S   YL G FS  IKLPA  TAGVV AFY+S+ +     HDEIDFEFLGN  G+   +QTN++  G  +  RE+R  LWFDPS  +H YS+LW   QI+F++D IPIR FK    +G  FP  +PM LY+++W+  DWAT GG  + N+  AP++  +  F + GC         +K   T+       +    +   Q  +++    K   Y+YC D+ R+ V P EC
Sbjct:   64 TGTGFQSKGSYLFGHFSMHIKLPAGDTAGVVTAFYLSSTN---NEHDEIDFEFLGNRTGQPVILQTNVFTGGKGN--REQRIYLWFDPSKAYHTYSVLWNLYQIVFFVDNIPIRVFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLEKTNWANAPFIASYRGFHIDGCQ----ASVEAKYCATQGRMWWDQNEFRDLDAEQYRRLKWVRMKWTIYNYCTDRTRFPVMPAEC 289          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH7_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 7 OS=Arabidopsis thaliana GN=XTH7 PE=2 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 1.480e-43
Identity = 92/233 (39.48%), Postives = 133/233 (57.08%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPA-KPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSF-DPIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            +G GF S   YL G  S  IKL    +AG V AFYM++    +   DE+DFEFLGN  G+ + +QTN++ +G     RE+R NLWFDPS DFH+Y+I W   +I+FY+D +PIR +K   +    +P  +PM +Y+T+W+  DWAT GG  ++N+  AP+   + DF + GC    P +  ++  +  E S       +SP +          HM Y YC D+ R+ VPP EC
Sbjct:   64 SGCGFASKKQYLFGRVSMKIKLIPGDSAGTVTAFYMNSDT--DSVRDELDFEFLGNRSGQPYTVQTNVFAHGKGD--REQRVNLWFDPSRDFHEYAISWNHLRIVFYVDNVPIRVYKNNEARKVPYPRFQPMGVYSTLWEADDWATRGGIEKINWSRAPFYAYYKDFDIEGCPVPGPADCPANSKNWWEGSAYH---QLSPVEARSYRWVRVNHMVYDYCTDKSRFPVPPPEC 289          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH9_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 9 OS=Arabidopsis thaliana GN=XTH9 PE=2 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 4.307e-43
Identity = 95/234 (40.60%), Postives = 131/234 (55.98%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPA-KPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIPT--GVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            +G+GF S   YL G  S  IKL    +AG V AFYMS+      NH+E DFEFLGN  G+ + +QTNIY NG  +  RE+R NLWFDP+ +FH YSILW+   ++F +D  PIR  K     G  F   + M +Y++IW+  DWAT GG  + ++ +AP+V  + +F +  C   P     SKC+  +      PT   +S  Q  ++      HM Y YC+D  R+ V P EC
Sbjct:   57 SGAGFESRSKYLFGKVSIQIKLVEGDSAGTVTAFYMSSDG---PNHNEFDFEFLGNTTGEPYIVQTNIYVNGVGN--REQRLNLWFDPTTEFHTYSILWSKRSVVFMVDETPIRVQKNLEEKGIPFAKDQAMGVYSSIWNADDWATQGGLVKTDWSHAPFVASYKEFQIDACEI-PTTTDLSKCNGDQKFWWDEPTVSELSLHQNHQLIWVRANHMIYDYCFDATRFPVTPLEC 284          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH6_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana GN=XTH6 PE=2 SV=2)

HSP 1 Score: 174.866 bits (442), Expect = 5.626e-43
Identity = 94/233 (40.34%), Postives = 134/233 (57.51%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFP-AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSF-DPIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            TG GF S   YL G  S  IKL    +AG V AFYM++     +  DE+DFEFLGN  G+ + +QTNI+ +G     RE+R NLWFDPS D+H Y+ILW+   I+FY+D +PIRE+K   +    +P ++PM +Y+T+W+  DWAT GG  ++++  AP+   + DF + GC    P    S+  +  E         V  ++R +       HM Y YC D+ R+ VPP EC
Sbjct:   65 TGCGFASKRKYLFGRVSMKIKLIPGDSAGTVTAFYMNSDTATVR--DELDFEFLGNRSGQPYSVQTNIFAHGKGD--REQRVNLWFDPSMDYHTYTILWSHKHIVFYVDDVPIREYKNNEAKNIAYPTSQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPGPTFCPSNPHNWWEGYAYQSLNAVE-ARRYRWVRV--NHMVYDYCTDRSRFPVPPPEC 290          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH1_SOLLC (Probable xyloglucan endotransglucosylase/hydrolase 1 OS=Solanum lycopersicum GN=XTH1 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.637e-42
Identity = 91/235 (38.72%), Postives = 135/235 (57.45%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFP-AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSK---VSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            +G+GF S   YL G FS  ++L    +AGVV AFY+S+ +     HDEIDFEFLGN  G+ + +QTN++  G  +  RE+R  LWFDP+  +H YS+LW    I+ ++D +PIR FK +  +G  FP  +PM +Y+++WD  DWAT GG  + N+  AP+   ++ F + GC      Q    C+ T+  K         +   Q  ++    +K+  Y+YC D+ RY VPP EC
Sbjct:   63 SGAGFQSKKSYLFGHFSMKMRLVGGDSAGVVTAFYLSSNNA---EHDEIDFEFLGNRTGQPYILQTNVFTGGKGN--REQRIYLWFDPTKGYHSYSVLWNTYLIVIFVDDVPIRAFKNSKDLGVKFPFNQPMKIYSSLWDADDWATRGGLEKTNWANAPFTASYTSFHVDGCE-AATPQEVQVCN-TKGMKWWDQKAFQDLDALQYRRLRWVRQKYTVYNYCTDKARYPVPPPEC 290          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTHA_PHAAN (Xyloglucan endotransglucosylase/hydrolase protein A OS=Phaseolus angularis GN=XTHA PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.061e-41
Identity = 92/234 (39.32%), Postives = 130/234 (55.56%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFP-AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIP--TGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            TG+GF S   YL G FS  IKL    +AG V AFY+S+ +     HDEIDFEFLGN  G+ + +QTN++  G     RE+R  LWFDP+  +H+YS+LW   QI+FY+D  PIR FK +  +G  FP  +PM +Y ++W+  DWAT GG  + ++  AP++  +  F + GC        +  CD         P    +  +Q  K+     K+  Y+YC D+ RY   P EC
Sbjct:   61 TGTGFQSKGSYLFGHFSMYIKLVPGDSAGTVTAFYLSSTNA---EHDEIDFEFLGNRTGQPYILQTNVFTGGKGD--REQRIYLWFDPTTQYHRYSVLWNMYQIVFYVDDYPIRVFKNSNDLGVKFPFNQPMKIYNSLWNADDWATRGGLEKTDWSKAPFIASYKGFHIDGCE---ASVNAKFCDTQGKRWWDQPEFRDLDAAQWQKLAWVRNKYTIYNYCTDRKRYSQVPPEC 286          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH_TOBAC (Probable xyloglucan endotransglucosylase/hydrolase protein OS=Nicotiana tabacum GN=XTH PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 3.087e-41
Identity = 88/235 (37.45%), Postives = 133/235 (56.60%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFP-AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSF---DPIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            +G+GF S   YL G FS  +KL    +AGVV AFY+S+ +     HDEIDFEFLGN  G+ + +QTN++  G     RE+R  LWFDP+  +H YS+LW   QI+ ++D +PIR FK +  +G  FP  +PM +Y+++WD  DWAT GG  + ++  AP+   ++ F + GC       ++  ++K       K          +R++     +K+  Y+YC D+ RY   P EC
Sbjct:   62 SGAGFQSKKSYLFGHFSMKLKLVGGDSAGVVTAFYLSSNNA---EHDEIDFEFLGNRTGQPYILQTNVFTGGKGD--REQRIYLWFDPTKGYHSYSVLWNTFQIVIFVDDVPIRAFKNSKDLGVKFPFNQPMKIYSSLWDADDWATRGGLEKTDWSNAPFTASYTSFHVDGCEAATPQEVQVCNTKGMRWWDQKAFQDLDALQYRRLRW--VRQKYTIYNYCTDRKRYPTLPPEC 289          
The following BLAST results are available for this feature:
BLAST of EY659217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
XTH32_ARATH4.162e-4642.73Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH8_ARATH6.011e-4539.75Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH4_ARATH1.749e-4442.49Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH_BRAOB1.134e-4341.28Xyloglucan endotransglucosylase/hydrolase OS=Brass... [more]
XTH7_ARATH1.480e-4339.48Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH9_ARATH4.307e-4340.60Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH6_ARATH5.626e-4340.34Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH1_SOLLC1.637e-4238.72Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTHA_PHAAN1.061e-4139.32Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH_TOBAC3.087e-4137.45Probable xyloglucan endotransglucosylase/hydrolase... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659217 ID=EY659217|Name=EY659217|organism=Citrus sinensis|type=EST|length=898bp
GTTCATAGAGATGGAAAATCTGTTCATTTATCTCTAGATGAAAGACAGGG
TCTGGATTTGTGTCACATGACCTCTATCTTCATGGTTTCTTCAGTGCTTC
AATAAAGTTGCCTGCTGATTATACTGCCGGCGTTGTTGTTGCCTTCTATA
TGTCAAATGGTGACATGTTTGAGAAGAATCATGATGAAATAGACTTTGAG
TTCTTGGGTAATATTAGAGGCAAAAATTGGAGGATTCAGACTAATATTTA
TGGCAATGGAAGCACCAGCATCGGAAGAGAAGAGAGATACAATCTCTGGT
TTGATCCTTCTGATGATTTCCATCAGTACAGTATTCTCTGGACTGATTCC
CAGATCATATTTTATATAGACGGTATTCCAATTAGGGAGTTTAAGAGAAC
TGCATCTATGGGAGGAGATTTTCCTGCTAAGCCGATGTCTTTGTACGCCA
CAATCTGGGATGGCTCTGATTGGGCTACAAATGGTGGCAAATACCGAGTG
AACTACAAATATGCTCCCTATGTGACTGAATTCTCTGACTTCGTACTCCA
CGGATGTTCATTTGATCCTATTGAGCAAACTTCTTCCAAGTGTGACATAA
CCGAAAGTTCCAAAGTATCAATCCCTACTGGCGTCTCCCCATCACAGAGA
ATTAAAATGGAAAACTTTANGAGGAAGCATATGACCTATTCCTACTGCTA
TGACCAAATTCGATACAAAGTTCCTCCATTTGAGTGTGTGATCAACCCCC
TTGAGGCGGAGCGCCTTAAAGTACACGATCCAGTTACATTCNGGGGGAGG
GCGGCGCCATCACGGGAAACGACACCACCGAGCCGATCAAGCGAACCAAG
NNCAATGACGTTGAGGAGACTATATGCTACATGCAGACACTATTTGTC
back to top