EY675319
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY675319 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 7.502e-13 Identity = 37/62 (59.68%), Postives = 46/62 (74.19%), Query Frame = 1 Query: 142 AFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFV-QAIVTGKGPIENLYDHIADPVANN 324 AFDPLG + DP +F ELKVKE+KNGRLA+ ++ GF V Q+ G GP+ENL H+ADP NN Sbjct: 172 AFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNN 233
BLAST of EY675319 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 2.413e-11 Identity = 31/57 (54.39%), Postives = 43/57 (75.44%), Query Frame = 1 Query: 145 FDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPV 315 FDPLGLA DP++ A+L++ E+K+ RLAM + GF VQA TGKGP+ N H++DP+ Sbjct: 223 FDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPL 279
BLAST of EY675319 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 9.171e-11 Identity = 31/57 (54.39%), Postives = 41/57 (71.93%), Query Frame = 1 Query: 145 FDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPV 315 FDPLGLA DP + A+L++ E+K+ RLAM GF VQA TGKGP+ N H++DP+ Sbjct: 220 FDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPL 276 The following BLAST results are available for this feature:
BLAST of EY675319 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 73
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY675319 ID=EY675319; Name=EY675319; organism=Citrus sinensis; type=EST; length=1037bpback to top |