EY650153
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY650153 vs. ExPASy Swiss-Prot
Match: RBS2_THIFE (Ribulose bisphosphate carboxylase small chain 2 OS=Thiobacillus ferrooxidans GN=cbbS2 PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 3.398e-12 Identity = 31/91 (34.07%), Postives = 50/91 (54.95%), Query Frame = 3 Query: 273 LSDESLLKEISYLLRSGWIPCLEFELEKGWVYREHHN*PGFYYGRYWTMWKLPMYGCTDATHVLNEVGEVQNEYPHSFVRIIGFDNMREAQ 545 L+ + + ++++Y++ GW P +E H P +G YW MWKLPM+G TD +L E PH+ VRI+G+DN +++Q Sbjct: 28 LTADEIRQQVAYIVSKGWNPAVE------------HTEPENAFGNYWYMWKLPMFGETDVDTILKEAERCHKRNPHNHVRIVGYDNFKQSQ 106 HSP 2 Score: 21.557 bits (44), Expect = 3.398e-12 Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = 2 Query: 242 KFDTLSYLP 268 KF+TLSYLP Sbjct: 18 KFETLSYLP 26
BLAST of EY650153 vs. ExPASy Swiss-Prot
Match: RBS_ANASP (Ribulose bisphosphate carboxylase small chain OS=Anabaena sp. (strain PCC 7120) GN=cbbS PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 1.635e-11 Identity = 32/100 (32.00%), Postives = 55/100 (55.00%), Query Frame = 3 Query: 273 LSDESLLKEISYLLRSGWIPCLEFELEKGWVYREHHN*PGFYYGRYWTMWKLPMYGCTDATHVLNEVGEVQNEYPHSFVRIIGFDNMREAQCIILLAANP 572 L+D + K++ Y+L G+IP +EF N YWT+WKLP++G + VL EV +++YP ++R++GFDN+++ Q + + P Sbjct: 19 LTDVQIEKQVQYILSQGYIPAVEF------------NEVSEPTELYWTLWKLPLFGAKTSREVLAEVQSCRSQYPGHYIRVVGFDNIKQCQILSFIVHKP 106 The following BLAST results are available for this feature:
BLAST of EY650153 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 112
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY650153 ID=EY650153; Name=EY650153; organism=Citrus sinensis; type=EST; length=954bpback to top |