CX300756
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX300756 vs. ExPASy Swiss-Prot
Match: UBC19_ARATH (Ubiquitin carrier protein E2 19 OS=Arabidopsis thaliana GN=UBC19 PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.175e-11 Identity = 32/59 (54.24%), Postives = 42/59 (71.19%), Query Frame = 3 Query: 420 FPGT-FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 593 F GT ++L+L F+ DYP K P V+F + FHPN+ G+ICLDILQ++WS YDV IL Sbjct: 80 FEGTEYRLSLTFSNDYPFKSPKVKFETCCFHPNVDLYGNICLDILQDKWSSAYDVRTIL 138
BLAST of CX300756 vs. ExPASy Swiss-Prot
Match: UBC11_SCHPO (Ubiquitin-conjugating enzyme E2-20 kDa OS=Schizosaccharomyces pombe GN=ubc11 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.175e-11 Identity = 27/54 (50.00%), Postives = 40/54 (74.07%), Query Frame = 3 Query: 432 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 593 FK+++ F +YP PPT+ F S M+HPN+ G+ICLDIL+++WS +Y+V IL Sbjct: 78 FKISMSFPANYPYSPPTIIFTSPMWHPNVDMSGNICLDILKDKWSAVYNVQTIL 131
BLAST of CX300756 vs. ExPASy Swiss-Prot
Match: UBE2C_MOUSE (Ubiquitin-conjugating enzyme E2 C OS=Mus musculus GN=Ube2c PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.065e-11 Identity = 27/54 (50.00%), Postives = 40/54 (74.07%), Query Frame = 3 Query: 432 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 593 +KL+L+F YP PTV+F++ +HPN+ G+ICLDIL+++WS +YDV IL Sbjct: 79 YKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTIL 132
BLAST of CX300756 vs. ExPASy Swiss-Prot
Match: UBE2C_MACFA (Ubiquitin-conjugating enzyme E2 C OS=Macaca fascicularis GN=UBE2C PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.065e-11 Identity = 27/54 (50.00%), Postives = 40/54 (74.07%), Query Frame = 3 Query: 432 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 593 +KL+L+F YP PTV+F++ +HPN+ G+ICLDIL+++WS +YDV IL Sbjct: 79 YKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTIL 132
BLAST of CX300756 vs. ExPASy Swiss-Prot
Match: UBE2C_BOVIN (Ubiquitin-conjugating enzyme E2 C OS=Bos taurus GN=UBE2C PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.065e-11 Identity = 27/54 (50.00%), Postives = 40/54 (74.07%), Query Frame = 3 Query: 432 FKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 593 +KL+L+F YP PTV+F++ +HPN+ G+ICLDIL+++WS +YDV IL Sbjct: 79 YKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTIL 132 The following BLAST results are available for this feature:
BLAST of CX300756 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 75
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300756 ID=CX300756; Name=CX300756; organism=Citrus sinensis; type=EST; length=598bpback to top |