DR908612
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_CHLSC (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Chloranthus spicatus GN=ndhE PE=3 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 3.659e-14 Identity = 40/41 (97.56%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_LIRTU (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Liriodendron tulipifera GN=ndhG PE=3 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 4.485e-14 Identity = 27/36 (75.00%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ R+NQIIEQDL SN QQIGIHLSTDF+LPFE Sbjct: 122 GIIWTTRSNQIIEQDLTSNVQQIGIHLSTDFYLPFE 157 HSP 2 Score: 40.817 bits (94), Expect = 4.485e-14 Identity = 18/20 (90.00%), Postives = 18/20 (90.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLITTI DTSWYGIIWTT S Sbjct: 110 SLITTISDTSWYGIIWTTRS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_GOSHI (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Gossypium hirsutum GN=ndhE PE=3 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 4.779e-14 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEH+LVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MMLEHILVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_DRIGR (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Drimys granadensis GN=ndhE PE=3 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 4.779e-14 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEHVL+LSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MMLEHVLILSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_COFAR (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Coffea arabica GN=ndhG PE=3 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 5.828e-14 Identity = 26/36 (72.22%), Postives = 32/36 (88.89%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ ++NQI+EQDLI+NSQQIG+HLSTDFFLPFE Sbjct: 122 GIIWTTKSNQILEQDLITNSQQIGVHLSTDFFLPFE 157 HSP 2 Score: 38.5058 bits (88), Expect = 5.828e-14 Identity = 17/20 (85.00%), Postives = 17/20 (85.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLITTI D SWYGIIWTT S Sbjct: 110 SLITTIPDMSWYGIIWTTKS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_DIOEL (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Dioscorea elephantipes GN=ndhG PE=3 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.828e-14 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ R+NQIIEQDLISN QQIGIHLST+F+LPFE Sbjct: 122 GIIWTTRSNQIIEQDLISNVQQIGIHLSTNFYLPFE 157 HSP 2 Score: 40.4318 bits (93), Expect = 5.828e-14 Identity = 18/20 (90.00%), Postives = 18/20 (90.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLITTI DTSWYGIIWTT S Sbjct: 110 SLITTIPDTSWYGIIWTTRS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_CHLSC (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Chloranthus spicatus GN=ndhG PE=3 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.828e-14 Identity = 27/36 (75.00%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ R+NQIIEQDL SN QQIGIHLSTDF+LPFE Sbjct: 122 GIIWTTRSNQIIEQDLTSNVQQIGIHLSTDFYLPFE 157 HSP 2 Score: 40.4318 bits (93), Expect = 5.828e-14 Identity = 18/20 (90.00%), Postives = 18/20 (90.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLITTI DTSWYGIIWTT S Sbjct: 110 SLITTIPDTSWYGIIWTTRS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_NANDO (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Nandina domestica GN=ndhG PE=3 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 5.828e-14 Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ R+NQIIEQDLI+ QQ+GIHLSTDFFLPFE Sbjct: 122 GIIWTTRSNQIIEQDLINKGQQLGIHLSTDFFLPFE 157 HSP 2 Score: 40.817 bits (94), Expect = 5.828e-14 Identity = 18/20 (90.00%), Postives = 18/20 (90.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLITTI DTSWYGIIWTT S Sbjct: 110 SLITTISDTSWYGIIWTTRS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_CERDE (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Ceratophyllum demersum GN=ndhG PE=3 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 5.828e-14 Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ R+NQIIEQDL SN QQ+GIHLSTDF+LPFE Sbjct: 122 GIIWTTRSNQIIEQDLTSNVQQMGIHLSTDFYLPFE 157 HSP 2 Score: 41.5874 bits (96), Expect = 5.828e-14 Identity = 18/20 (90.00%), Postives = 19/20 (95.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLITTIL+TSWYGIIWTT S Sbjct: 110 SLITTILETSWYGIIWTTRS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_DRANE (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Draba nemorosa GN=ndhG PE=3 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 7.572e-14 Identity = 28/30 (93.33%), Postives = 29/30 (96.67%), Query Frame = 1 Query: 58 RANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 R NQI+EQDLISNSQQIGIHLSTDFFLPFE Sbjct: 128 RLNQILEQDLISNSQQIGIHLSTDFFLPFE 157 HSP 2 Score: 37.3502 bits (85), Expect = 7.572e-14 Identity = 15/18 (83.33%), Postives = 17/18 (94.44%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTT 56 SLI+TILDTSWY +IWTT Sbjct: 110 SLISTILDTSWYRVIWTT 127 The following BLAST results are available for this feature:
BLAST of DR908612 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 160
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DR908612 ID=DR908612; Name=DR908612; organism=Citrus sinensis; type=EST; length=607bpback to top |