DR908612
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_CAPBU (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Capsella bursa-pastoris GN=ndhG PE=3 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 7.572e-14 Identity = 28/36 (77.78%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ + NQI+EQDLISNSQQIGIHLSTDFFLPFE Sbjct: 122 GVIWTTKLNQILEQDLISNSQQIGIHLSTDFFLPFE 157 HSP 2 Score: 37.7354 bits (86), Expect = 7.572e-14 Identity = 14/17 (82.35%), Postives = 17/17 (100.00%), Query Frame = 3 Query: 6 LITTILDTSWYGIIWTT 56 L++TILDTSWYG+IWTT Sbjct: 111 LMSTILDTSWYGVIWTT 127
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_ARATH (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Arabidopsis thaliana GN=ndhG PE=3 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 7.572e-14 Identity = 28/36 (77.78%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ + NQI+EQDLISNSQQIGIHLSTDFFLPFE Sbjct: 122 GVIWTTKLNQILEQDLISNSQQIGIHLSTDFFLPFE 157 HSP 2 Score: 37.7354 bits (86), Expect = 7.572e-14 Identity = 14/17 (82.35%), Postives = 17/17 (100.00%), Query Frame = 3 Query: 6 LITTILDTSWYGIIWTT 56 L++TILDTSWYG+IWTT Sbjct: 111 LMSTILDTSWYGVIWTT 127
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_DRIGR (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Drimys granadensis GN=ndhG PE=3 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 7.572e-14 Identity = 27/36 (75.00%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ +NQIIEQDLISN QQIGIHLSTDF+LPFE Sbjct: 122 GIIWTTGSNQIIEQDLISNVQQIGIHLSTDFYLPFE 157 HSP 2 Score: 40.817 bits (94), Expect = 7.572e-14 Identity = 18/20 (90.00%), Postives = 18/20 (90.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLITTI DTSWYGIIWTT S Sbjct: 110 SLITTISDTSWYGIIWTTGS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_PANGI (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Panax ginseng GN=ndhE PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 8.151e-14 Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEHVLVLSAYLFS+G+YGLITSRNM RALMCLELILNAV Sbjct: 1 MMLEHVLVLSAYLFSVGLYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_LACSA (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Lactuca sativa GN=ndhE PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 8.151e-14 Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEHVLVLSAYLFS+G+YGLITSRNM RALMCLELILNAV Sbjct: 1 MMLEHVLVLSAYLFSVGLYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_HELAN (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Helianthus annuus GN=ndhE PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 8.151e-14 Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEHVLVLSAYLFS+G+YGLITSRNM RALMCLELILNAV Sbjct: 1 MMLEHVLVLSAYLFSVGLYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_FAGEA (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Fagopyrum esculentum subsp. ancestrale GN=ndhE PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 8.151e-14 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEHVLVLSAYLFSIGIYGLITSRN+ RALMCLELILNAV Sbjct: 1 MMLEHVLVLSAYLFSIGIYGLITSRNLVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_DAUCA (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Daucus carota GN=ndhE PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 8.151e-14 Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEHVLVLSAYLFS+G+YGLITSRNM RALMCLELILNAV Sbjct: 1 MMLEHVLVLSAYLFSVGLYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_CARPA (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Carica papaya GN=ndhE PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 8.151e-14 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MLLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_MANES (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Manihot esculenta GN=ndhG PE=3 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 9.838e-14 Identity = 28/36 (77.78%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ + NQIIEQDLISN QQIGIHLSTDFFLPFE Sbjct: 122 GIIWTTKTNQIIEQDLISNGQQIGIHLSTDFFLPFE 157 HSP 2 Score: 37.3502 bits (85), Expect = 9.838e-14 Identity = 16/18 (88.89%), Postives = 16/18 (88.89%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTT 56 SLIT I DTSWYGIIWTT Sbjct: 110 SLITIIPDTSWYGIIWTT 127 The following BLAST results are available for this feature:
BLAST of DR908612 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 160
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DR908612 ID=DR908612; Name=DR908612; organism=Citrus sinensis; type=EST; length=607bpback to top |