DR908612
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_TRACE (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Trachelium caeruleum GN=ndhG PE=3 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 9.838e-14 Identity = 25/36 (69.44%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ ++NQIIEQDLI+NSQ+IGIHLSTDF +PFE Sbjct: 122 GIIWTTKSNQIIEQDLINNSQEIGIHLSTDFLIPFE 157 HSP 2 Score: 40.817 bits (94), Expect = 9.838e-14 Identity = 18/20 (90.00%), Postives = 18/20 (90.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLITTI DTSWYGIIWTT S Sbjct: 110 SLITTIPDTSWYGIIWTTKS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_CUCSA (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Cucumis sativus GN=ndhG PE=3 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 9.838e-14 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ R+NQI+EQDLISNSQQIGI+LST FFLPFE Sbjct: 122 GIIWTTRSNQILEQDLISNSQQIGIYLSTYFFLPFE 157 HSP 2 Score: 40.817 bits (94), Expect = 9.838e-14 Identity = 17/20 (85.00%), Postives = 19/20 (95.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SL+TTI+DTSWYGIIWTT S Sbjct: 110 SLMTTIVDTSWYGIIWTTRS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_PIPCE (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Piper cenocladum GN=ndhG PE=3 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 9.838e-14 Identity = 25/36 (69.44%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ R+NQI+EQDL+SN QQIGIHL TDF LPFE Sbjct: 122 GIIWTTRSNQIMEQDLLSNVQQIGIHLVTDFILPFE 157 HSP 2 Score: 43.1282 bits (100), Expect = 9.838e-14 Identity = 19/20 (95.00%), Postives = 19/20 (95.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLITTILDTSWYGIIWTT S Sbjct: 110 SLITTILDTSWYGIIWTTRS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_TOBAC (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Nicotiana tabacum GN=ndhE PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.065e-13 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_SOLTU (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Solanum tuberosum GN=ndhE PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.065e-13 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_SOLLC (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Solanum lycopersicum GN=ndhE PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.065e-13 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_SOLBU (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Solanum bulbocastanum GN=ndhE PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.065e-13 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_PLAOC (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Platanus occidentalis GN=ndhE PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.065e-13 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_NICTO (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Nicotiana tomentosiformis GN=ndhE PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.065e-13 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_NICSY (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Nicotiana sylvestris GN=ndhE PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.065e-13 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41 The following BLAST results are available for this feature:
BLAST of DR908612 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 160
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DR908612 ID=DR908612; Name=DR908612; organism=Citrus sinensis; type=EST; length=607bpback to top |