DR908612
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_EUCGG (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=ndhE PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.065e-13 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_BUXMI (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Buxus microphylla GN=ndhE PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.065e-13 Identity = 39/41 (95.12%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEHVLVL AYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MMLEHVLVLGAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_ATRBE (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Atropa belladonna GN=ndhE PE=3 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.065e-13 Identity = 39/41 (95.12%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_SPIOL (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Spinacia oleracea GN=ndhG PE=3 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 1.278e-13 Identity = 26/36 (72.22%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ ++NQI+EQDLI+ SQQIGIHLSTDFFLPFE Sbjct: 122 GIIWTTKSNQILEQDLINASQQIGIHLSTDFFLPFE 157 HSP 2 Score: 40.0466 bits (92), Expect = 1.278e-13 Identity = 17/20 (85.00%), Postives = 19/20 (95.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLI+TIL+TSWYGIIWTT S Sbjct: 110 SLISTILNTSWYGIIWTTKS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU6C_PELHO (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Pelargonium hortorum GN=ndhG PE=3 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 1.661e-13 Identity = 25/36 (69.44%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 40 GLFGLHRANQIIEQDLISNSQQIGIHLSTDFFLPFE 147 G+ ++NQIIE+D ISNSQQ+GI LSTDFFLPFE Sbjct: 122 GILWTTKSNQIIEKDFISNSQQLGILLSTDFFLPFE 157 HSP 2 Score: 42.743 bits (99), Expect = 1.661e-13 Identity = 18/20 (90.00%), Postives = 19/20 (95.00%), Query Frame = 3 Query: 3 SLITTILDTSWYGIIWTTPS 62 SLITTILDTSWYGI+WTT S Sbjct: 110 SLITTILDTSWYGILWTTKS 129
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_NANDO (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Nandina domestica GN=ndhE PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.816e-13 Identity = 39/41 (95.12%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEHVLVLSAYL SIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MMLEHVLVLSAYLLSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_LIRTU (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Liriodendron tulipifera GN=ndhE PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.816e-13 Identity = 38/41 (92.68%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MM EHVL+LSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MMTEHVLILSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_CERDE (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Ceratophyllum demersum GN=ndhE PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.816e-13 Identity = 39/41 (95.12%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 MMLEH LVLSAYLFSIGIYGLITSRNM RALMCLELILNAV Sbjct: 1 MMLEHELVLSAYLFSIGIYGLITSRNMVRALMCLELILNAV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_OENPA (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Oenothera parviflora GN=ndhE PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 2.372e-13 Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILN+V Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSV 41
BLAST of DR908612 vs. ExPASy Swiss-Prot
Match: NU4LC_OENEH (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic OS=Oenothera elata subsp. hookeri GN=ndhE PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 2.372e-13 Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 484 MMLEHVLVLSAYLFSIGIYGLITSRNMGRALMCLELILNAV 606 M+LEHVLVLSAYLFSIGIYGLITSRNM RALMCLELILN+V Sbjct: 1 MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSV 41 The following BLAST results are available for this feature:
BLAST of DR908612 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 160
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DR908612 ID=DR908612; Name=DR908612; organism=Citrus sinensis; type=EST; length=607bpback to top |