DR403317
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR403317 vs. ExPASy Swiss-Prot
Match: RC21_ARATH (UPF0057 membrane protein At1g57550 OS=Arabidopsis thaliana GN=At1g57550 PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 6.875e-12 Identity = 26/48 (54.17%), Postives = 40/48 (83.33%), Query Frame = 2 Query: 167 VDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 310 +++L A+ +PP+GVFL++G EFW+CLLLT+ +IPG+IYA+Y +TK Sbjct: 5 LEVLCAIFIPPVGVFLRYGLGLEFWVCLLLTLFAFIPGLIYAIYVLTK 52
BLAST of DR403317 vs. ExPASy Swiss-Prot
Match: RC22_ARATH (UPF0057 membrane protein At2g24040 OS=Arabidopsis thaliana GN=At2g24040 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.000e-11 Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 2 Query: 152 STATCVDILLAVILPPLGVFLKFGC-KAEFWICLLLTILGYIPGIIYAVYAI 304 S C +I +A++LPP+GV L+ GC EF+ICL+LT LGY+PGIIYA+YAI Sbjct: 4 SCELCCEIFIAILLPPVGVCLRHGCCTVEFFICLILTCLGYLPGIIYAIYAI 55
BLAST of DR403317 vs. ExPASy Swiss-Prot
Match: PMP3_GIBZE (Plasma membrane proteolipid 3 OS=Gibberella zeae GN=PMP3 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.613e-11 Identity = 32/46 (69.57%), Postives = 41/46 (89.13%), Query Frame = 2 Query: 173 ILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 310 I+LA+ILPP+GVFL+ GC A+F+I +LLTILGYIPGII+A+Y I K Sbjct: 21 IILAIILPPVGVFLERGCGADFFINILLTILGYIPGIIHALYIILK 66
BLAST of DR403317 vs. ExPASy Swiss-Prot
Match: RC23_ARATH (UPF0057 membrane protein At4g30650 OS=Arabidopsis thaliana GN=At4g30650 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.412e-11 Identity = 36/56 (64.29%), Postives = 42/56 (75.00%), Query Frame = 2 Query: 140 MADGSTATCVDILLAVILPPLGVFLKFGC-KAEFWICLLLTILGYIPGIIYAVYAI 304 MA C +IL+A++LPPLGV LK GC EF ICL+LTILGYIPGIIYA+Y I Sbjct: 1 MASNMEVFC-EILIAILLPPLGVCLKRGCCTVEFLICLVLTILGYIPGIIYALYVI 55
BLAST of DR403317 vs. ExPASy Swiss-Prot
Match: PMP3_CRYNE (Plasma membrane proteolipid 3 OS=Cryptococcus neoformans GN=PMP3 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 4.457e-11 Identity = 35/53 (66.04%), Postives = 42/53 (79.25%), Query Frame = 2 Query: 161 TCVDI---LLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 310 TC DI +LA+ILPPLGVFL+ GC A+ I +LLTILGYIPGII+A+Y I K Sbjct: 4 TCSDIFKIILAIILPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILK 56
BLAST of DR403317 vs. ExPASy Swiss-Prot
Match: Y567_PSEAE (UPF0057 membrane protein PA0567 OS=Pseudomonas aeruginosa GN=PA0567 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 5.820e-11 Identity = 29/49 (59.18%), Postives = 40/49 (81.63%), Query Frame = 2 Query: 167 VDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITKK 313 + IL+A++LPPLGVFL+ G FW+ +LLT+LGYIPGI++AVY I K+ Sbjct: 4 IRILIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVHAVYIIAKR 52
BLAST of DR403317 vs. ExPASy Swiss-Prot
Match: YCU3_CAEEL (UPF0057 membrane protein T23F2.3 OS=Caenorhabditis elegans GN=T23F2.3 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11 Identity = 33/51 (64.71%), Postives = 38/51 (74.51%), Query Frame = 2 Query: 161 TCVDI---LLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 304 TC DI + AV+LPP+GVFL+ GC IC+LLTILGYIPGIIYA Y I Sbjct: 4 TCTDIPKFICAVLLPPIGVFLEKGCDYHLAICILLTILGYIPGIIYACYVI 54
BLAST of DR403317 vs. ExPASy Swiss-Prot
Match: YCU4_CAEEL (UPF0057 membrane protein T23F2.4 OS=Caenorhabditis elegans GN=T23F2.4 PE=2 SV=2) HSP 1 Score: 67.0106 bits (162), Expect = 9.928e-11 Identity = 33/51 (64.71%), Postives = 39/51 (76.47%), Query Frame = 2 Query: 161 TCVDI---LLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 304 TC+DI L A++LPP+GVFL+ GC IC+LLTILGYIPGIIYA Y I Sbjct: 4 TCMDIPKFLFALLLPPVGVFLEKGCTHHLAICILLTILGYIPGIIYACYII 54 The following BLAST results are available for this feature:
BLAST of DR403317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 18
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DR403317 ID=DR403317; Name=DR403317; organism=Citrus sinensis; type=EST; length=666bpback to top |