DR403235
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8H_ARATH (Autophagy-related protein 8h OS=Arabidopsis thaliana GN=ATG8H PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 3.926e-17 Identity = 26/54 (48.15%), Postives = 39/54 (72.22%), Query Frame = 2 Query: 227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388 + KYLVP D+TVG F++++ KR++L KA+F+FV N LP TA+ M ++Y K Sbjct: 49 KNKYLVPRDMTVGHFIHMLSKRMQLDPSKALFVFVHNTLPQTASRMDSLYNTFK 102 HSP 2 Score: 46.9802 bits (110), Expect = 3.926e-17 Identity = 22/43 (51.16%), Postives = 29/43 (67.44%), Query Frame = 3 Query: 102 SFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDK 230 SFK + + R ES I KYPDRIPVI+EK +D+PD++K Sbjct: 7 SFKDQFSSDERLKESNNIIAKYPDRIPVIIEKYSNADLPDMEK 49
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8L_DICDI (Autophagy-related protein 8-like protein DDB_G0290491 OS=Dictyostelium discoideum GN=DDB_G0290491 PE=3 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 8.532e-17 Identity = 26/49 (53.06%), Postives = 38/49 (77.55%), Query Frame = 3 Query: 87 AMAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233 A+ SFK E+ LE+R+ S++IR +Y DR+P+IVE+A SD+PDI+KK Sbjct: 2 ALLSKSFKQEYSLEKRKLISSKIRNRYKDRLPIIVERAANSDVPDINKK 50 HSP 2 Score: 46.9802 bits (110), Expect = 8.532e-17 Identity = 23/58 (39.66%), Postives = 41/58 (70.69%), Query Frame = 2 Query: 227 QKKYLVPADLTVGQFVYVVRKRIKLS---AEKAIFIFV-KNILPPTAAMMSAIYEENK 388 +KK+L P+++ + F+ +RK + S +KAIF+FV KN LPP++ ++S+IY+ +K Sbjct: 49 KKKFLAPSNMVITNFIMEIRKHLDDSDHNEQKAIFLFVNKNNLPPSSQLLSSIYDAHK 106 The following BLAST results are available for this feature:
BLAST of DR403235 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DR403235 ID=DR403235; Name=DR403235; organism=Citrus sinensis; type=EST; length=388bpback to top |