DN620939
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E131_ARATH (Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis thaliana GN=At1g11820 PE=1 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 4.059e-11 Identity = 31/74 (41.89%), Postives = 46/74 (62.16%), Query Frame = -1 Query: 510 DEDEAGATPENAKKYNGNLIKLISSKKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSLGI 731 D E AT +NA YN NLIK + + GTP+ P ++Y++ LFNE+L+ P SE ++GLF + +P Y L + Sbjct: 183 DSKEPYATIDNADTYNSNLIKHVFDRTGTPLHPEMTSSVYIYELFNEDLRAPPVSEASWGLFYGNSTPVYLLHV 256
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E13A_SOLLC (Glucan endo-1,3-beta-glucosidase A OS=Solanum lycopersicum PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 5.301e-11 Identity = 33/71 (46.48%), Postives = 42/71 (59.15%), Query Frame = -1 Query: 516 EDEAGATPENAKKYNGNLIKLISSKKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSL 728 E AT ENA Y NLI + GTP +P + Y+FA+F+EN K G SE+++GLFKPD P Y L Sbjct: 263 EGHPSATLENAMTYYTNLINHVKGGAGTPKKPGRTIETYLFAMFDENRKDGKPSEQHFGLFKPDQRPKYQL 333
BLAST of DN620939 vs. ExPASy Swiss-Prot
Match: E132_ARATH (Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis thaliana GN=At1g66250 PE=1 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 5.301e-11 Identity = 32/72 (44.44%), Postives = 47/72 (65.28%), Query Frame = -1 Query: 516 DEDEAGATPENAKKYNGNLIKLISSKKGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSL 731 + +E AT +NA YN NLI+ + +K GTP RP ++ Y++ L+NE+ K G SE+N+GLF +G P Y L Sbjct: 280 ETNEPDATLDNANTYNSNLIRHVLNKTGTPKRPGIAVSTYIYELYNEDTKAG-LSEKNWGLFNANGEPVYVL 350 The following BLAST results are available for this feature:
BLAST of DN620939 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN620939 ID=DN620939; Name=DN620939; organism=Citrus sinensis; type=EST; length=731bpback to top |