DN618246
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN618246 vs. ExPASy Swiss-Prot
Match: ACP_ANADF (Acyl carrier protein OS=Anaeromyxobacter sp. (strain Fw109-5) GN=acpP PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.879e-11 Identity = 32/75 (42.67%), Postives = 49/75 (65.33%), Query Frame = 3 Query: 162 SEVTDRVISVVKNFQKVDPSKVTVNAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEADKINTINMAVDFIASH 386 + V +V +++ + V ++ + + F DLG DSLD VE+VMA+EEEF EIPD EA+ I T+ AV++I +H Sbjct: 4 ANVEQKVKNIIADQLGVGEDEIKITSSFIEDLGADSLDIVELVMAMEEEFEVEIPDEEAENIKTVQDAVNYITTH 78
BLAST of DN618246 vs. ExPASy Swiss-Prot
Match: ACP_AKKM8 (Acyl carrier protein OS=Akkermansia muciniphila (strain ATCC BAA-835) GN=acpP PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.879e-11 Identity = 32/75 (42.67%), Postives = 49/75 (65.33%), Query Frame = 3 Query: 153 LDKSEVTDRVISVVKNFQKVDPSKVTVNAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEADKINTINMAVDFI 377 + + + ++V S++ + V+ KVT +A F DLG DSLDTVE+VMA EE F E+PD EA+K+ ++ V +I Sbjct: 1 MSDNSIEEKVRSIIVDQLGVESDKVTADAKFIEDLGADSLDTVELVMAFEENFDIEVPDEEAEKLQSVADVVAYI 75 The following BLAST results are available for this feature:
BLAST of DN618246 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 402
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN618246 ID=DN618246; Name=DN618246; organism=Citrus sinensis; type=EST; length=591bpback to top |