DN618145
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN618145 vs. ExPASy Swiss-Prot
Match: NEDD8_CAEEL (NEDD8 OS=Caenorhabditis elegans GN=ned-8 PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.788e-11 Identity = 31/50 (62.00%), Postives = 41/50 (82.00%), Query Frame = 2 Query: 398 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 547 M I VKTLTGK I L++E +D ++ +K K+++KEGIPP QQRLIFAGKQ+ Sbjct: 1 MLIKVKTLTGKEIELDIEPNDRVERIKEKVEEKEGIPPPQQRLIFAGKQM 50
BLAST of DN618145 vs. ExPASy Swiss-Prot
Match: NEDD8_DROME (NEDD8 OS=Drosophila melanogaster GN=Nedd8 PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.984e-11 Identity = 29/50 (58.00%), Postives = 41/50 (82.00%), Query Frame = 2 Query: 398 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL 547 M I VKTLTGK I +++E +D +D +K ++++KEGIPP QQRLIF+GKQ+ Sbjct: 1 MLIKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQM 50 The following BLAST results are available for this feature:
BLAST of DN618145 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 82
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN618145 ID=DN618145; Name=DN618145; organism=Citrus sinensis; type=EST; length=552bpback to top |