DN618139
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN618139 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1) HSP 1 Score: 98.2117 bits (243), Expect = 1.533e-20 Identity = 43/52 (82.69%), Postives = 48/52 (92.31%), Query Frame = 3 Query: 129 TATCVDILLAVILPPLGVFLKFGCKAEFWICLLMTILGYIPGIIYAVYAITK 284 TA C+DIL+A+ILPPLGVFLKFGC EFWICLL+T LGYIPGIIYA+YAITK Sbjct: 4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of DN618139 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2) HSP 1 Score: 98.2117 bits (243), Expect = 1.533e-20 Identity = 43/52 (82.69%), Postives = 48/52 (92.31%), Query Frame = 3 Query: 129 TATCVDILLAVILPPLGVFLKFGCKAEFWICLLMTILGYIPGIIYAVYAITK 284 TA C+DIL+A+ILPPLGVFLKFGC EFWICLL+T LGYIPGIIYA+YAITK Sbjct: 4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of DN618139 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1) HSP 1 Score: 96.2857 bits (238), Expect = 5.826e-20 Identity = 44/57 (77.19%), Postives = 50/57 (87.72%), Query Frame = 3 Query: 114 MADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLMTILGYIPGIIYAVYAITK 284 MAD STATC+DI+LA+ILPPLGVF KFGC EFWICLL+T GY+PGIIYAV+ ITK Sbjct: 1 MAD-STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56
BLAST of DN618139 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 2.891e-19 Identity = 40/53 (75.47%), Postives = 49/53 (92.45%), Query Frame = 3 Query: 126 STATCVDILLAVILPPLGVFLKFGCKAEFWICLLMTILGYIPGIIYAVYAITK 284 STAT V+I+LA+ILPPLGVFLKFGCK EFWICL++T+ GY+PGI+YA+Y ITK Sbjct: 2 STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54
BLAST of DN618139 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1) HSP 1 Score: 93.2041 bits (230), Expect = 4.932e-19 Identity = 39/53 (73.58%), Postives = 49/53 (92.45%), Query Frame = 3 Query: 126 STATCVDILLAVILPPLGVFLKFGCKAEFWICLLMTILGYIPGIIYAVYAITK 284 STAT VDI++A++LPPLGVFL+FGC EFWICL++T+LGYIPGIIYA+Y +TK Sbjct: 2 STATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54
BLAST of DN618139 vs. ExPASy Swiss-Prot
Match: OSR8_ORYSJ (Hydrophobic protein OSR8 OS=Oryza sativa subsp. japonica GN=OSR8 PE=3 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 1.485e-15 Identity = 39/56 (69.64%), Postives = 46/56 (82.14%), Query Frame = 3 Query: 114 MADGSTATCVDILLAVILPPLGVFLKFGC-KAEFWICLLMTILGYIPGIIYAVYAI 278 MA G T ++ILLA+ILPPLGVFL+FGC EF ICLL+TILGY+PGIIYAVY + Sbjct: 1 MASGRCCTFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVYVL 56
BLAST of DN618139 vs. ExPASy Swiss-Prot
Match: LT02_HORVU (Low temperature-induced protein lt101.2 OS=Hordeum vulgare GN=LT101.2 PE=2 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 1.485e-15 Identity = 33/51 (64.71%), Postives = 46/51 (90.20%), Query Frame = 3 Query: 126 STATCVDILLAVILPPLGVFLKFGCKAEFWICLLMTILGYIPGIIYAVYAI 278 ++AT ++++LA+ILPP+GVFL++G EFWICLL+T+LGYIPGIIYAVY + Sbjct: 2 ASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTLLGYIPGIIYAVYVL 52
BLAST of DN618139 vs. ExPASy Swiss-Prot
Match: LT01_HORVU (Low temperature-induced protein lt101.1 OS=Hordeum vulgare GN=LT101.1 PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.642e-14 Identity = 33/50 (66.00%), Postives = 44/50 (88.00%), Query Frame = 3 Query: 129 TATCVDILLAVILPPLGVFLKFGCKAEFWICLLMTILGYIPGIIYAVYAI 278 +AT ++++LA+ILPP+GVFL++ EFWICLL+TILGYIPGIIYAVY + Sbjct: 3 SATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52
BLAST of DN618139 vs. ExPASy Swiss-Prot
Match: ESI3_LOPEL (Salt stress-induced hydrophobic peptide ESI3 OS=Lophopyrum elongatum GN=ESI3 PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.642e-14 Identity = 33/50 (66.00%), Postives = 44/50 (88.00%), Query Frame = 3 Query: 129 TATCVDILLAVILPPLGVFLKFGCKAEFWICLLMTILGYIPGIIYAVYAI 278 +AT ++++LA+ILPP+GVFL++ EFWICLL+TILGYIPGIIYAVY + Sbjct: 3 SATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52
BLAST of DN618139 vs. ExPASy Swiss-Prot
Match: PMP3_DEBHA (Plasma membrane proteolipid 3 OS=Debaryomyces hansenii GN=PMP3 PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.537e-12 Identity = 33/53 (62.26%), Postives = 43/53 (81.13%), Query Frame = 3 Query: 135 TCVDI---LLAVILPPLGVFLKFGCKAEFWICLLMTILGYIPGIIYAVYAITK 284 TC DI ++A+ILPPLGVFL+ GC + FWI +++TILGYIPGII+A+Y I K Sbjct: 4 TCSDIFKIIIAIILPPLGVFLERGCASSFWINIVLTILGYIPGIIHALYVILK 56 The following BLAST results are available for this feature:
BLAST of DN618139 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 18
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN618139 ID=DN618139; Name=DN618139; organism=Citrus sinensis; type=EST; length=441bpback to top |