DN617969
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN617969 vs. ExPASy Swiss-Prot
Match: RD23A_BOVIN (UV excision repair protein RAD23 homolog A OS=Bos taurus GN=RAD23A PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.715e-11 Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = -1 Query: 228 GEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE 425 GE +G+ A M + VTP+E+EAIERL+A+GF +LV++ +FAC KNE LAAN+LL + E Sbjct: 298 GEVGAIGEEAPQM-NYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE 362
BLAST of DN617969 vs. ExPASy Swiss-Prot
Match: RD23B_HUMAN (UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 8.043e-11 Identity = 31/60 (51.67%), Postives = 42/60 (70.00%), Query Frame = -1 Query: 249 GGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL 428 GG G + + S + VTP+E+EAIERL+A+GF LV++ +FAC KNE LAAN+LL Sbjct: 344 GGSGGI-AEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLL 402 The following BLAST results are available for this feature:
BLAST of DN617969 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN617969 ID=DN617969; Name=DN617969; organism=Citrus sinensis; type=EST; length=431bpback to top |